SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003596 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003596
Domain Number 1 Region: 1088-1210
Classification Level Classification E-value
Superfamily PKD domain 3.47e-21
Family PKD domain 0.0025
Further Details:      
 
Domain Number 2 Region: 2020-2139
Classification Level Classification E-value
Superfamily PKD domain 2.35e-20
Family PKD domain 0.0029
Further Details:      
 
Domain Number 3 Region: 1680-1798
Classification Level Classification E-value
Superfamily PKD domain 2.49e-19
Family PKD domain 0.0058
Further Details:      
 
Domain Number 4 Region: 70-154
Classification Level Classification E-value
Superfamily L domain-like 3.49e-18
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 5 Region: 3114-3193
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.19e-17
Family Colipase-binding domain 0.049
Further Details:      
 
Domain Number 6 Region: 397-527
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-16
Family C-type lectin domain 0.0038
Further Details:      
 
Domain Number 7 Region: 1456-1541
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000301
Family PKD domain 0.0044
Further Details:      
 
Domain Number 8 Region: 1794-1882
Classification Level Classification E-value
Superfamily PKD domain 0.000000000128
Family PKD domain 0.0049
Further Details:      
 
Domain Number 9 Region: 1549-1628
Classification Level Classification E-value
Superfamily PKD domain 0.000000000262
Family PKD domain 0.0077
Further Details:      
 
Domain Number 10 Region: 1308-1376
Classification Level Classification E-value
Superfamily PKD domain 0.00000000275
Family PKD domain 0.0037
Further Details:      
 
Domain Number 11 Region: 1237-1291
Classification Level Classification E-value
Superfamily PKD domain 0.00000000785
Family PKD domain 0.0052
Further Details:      
 
Domain Number 12 Region: 1386-1457
Classification Level Classification E-value
Superfamily PKD domain 0.0000000235
Family PKD domain 0.0035
Further Details:      
 
Domain Number 13 Region: 1878-1967
Classification Level Classification E-value
Superfamily PKD domain 0.000000249
Family PKD domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003596   Gene: ENSPCAG00000003573   Transcript: ENSPCAT00000003830
Sequence length 4228
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6650:62088:101025:-1 gene:ENSPCAG00000003573 transcript:ENSPCAT00000003830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPARLVLALGLGLCLVALAADSGCGCWSCAPTCICGPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXDVSHNLLRALDMGLLGNLSALTELDISHNKISTLEEGAFAHSCNLSDIDLS
GNPLECDCGLAWLPRWAEAQGVRLGQPGGPTCAGPGPLAGRPLLSVPFLDSGCXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHPLCPSDTEIFPGNGHCYRLV
AEKAAWAQAQEQCRAWAGAALALVDSPAVQRFLITHVTRSLDVWIGFPAAEGEEEEAGEA
PRGEAFSMESCQNLPGEPHQATDEQCLRIGHAGQCNTDLCSAPHSFVNEMRPGGPVWDAE
NVLVGAPSGDLQGPLSPLLPQEVLAAPQEAVEVMVFPGLSLRREAFLTSAEFATQVLGRP
AQLRLQVFRLEGSSGAPGNSSEPGSRSLDNDTVLAPGCLPEESGCPVANVCVPLDMPGHS
EACVNGSMPEPGLSRAAYVLWKELLLAVPAGPAAQYSIALRDQDTPLLPGDLLVLQHDAG
PGALLQCPPARGSPGLEPPYLWAHASAWLARLPAQLEEAPDGLACVLRLLGAEEHLTPLL
GPNPKPGLQRPGRYEVRAVVSNGVSTRNLSCSFAVVSPVVGLRVVHPASLNGQLYVPTNH
SALVLAVDAGANTTAVAHWPGGNASAPFEAICPTVVDTLAPGCPHAANGTLFSVLVLPGL
SEGEHVVEVVATNGISQACLSLRVTAEEPVRGLRAMPSPESRVLQGMLVXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVSEVPAVLPQNTTLLLTAAVLVDSAVEVAFLWTFGDGEQVLGQFKPPYNESFPVPEPAV
AVVLVEHRATHTYVIPGDYNLTLLVSSALENLTQQMAIHVRTALPALAVEVSSPVLVSRR
PVTFFTWPSPSPGGGLYTWDFGDGSHSGPQSEPTINHTYAARGTYRVRLEATNNVSHMSA
QADIHVLEEPRGLNVHLCQSVEQXXXXXXXXXXXXXXNITWTFDMGDGTVLSGPEPTVEH
VYLRAQNCTVTVTAASPAGCLAQSRPVHVFVLEVLRVEPVGCIRAQPGALLTAHVTGDPA
HYVFEWVFGDGSPNATVRGSPVVTHNFTGTGTFALALVLSSRANKAHYFTSVCVEPELGN
VTLWPDRQFVRLGDAARLKACAWPPFSYHYAWEWGTEDATPTGGPEATHTYREAGSYLAT
VTVSNNVSAGDSAVVEVQEPVVLVGITVNSSHALETQQPYLFAVTGCGTPASYLWELGDG
GQLEGSSITYAYNHTGTFTVRVSGWNEVSHGQAWLNVTVVQRLQGLRVNASRSVVPLNGS
VSFSTTLEAGSDARYSWVLCDRCTPIPGGPTISYTFRSVGTFNIIVTAENAVGAAQDSIF
VYVLQHIEGLQVGGGGDGFFPTNHTLQLQAVVRDGTNVSFSWTAQQDGGPVQAATGRVFS
LTVLEPGTYLVQLRASNMLGSAMANRTLSFVDPVGLLTVAAAPNPAAVNESVTLAAELTG
GSSVTFTWGLGEGLHWVTLEPSTTHAFPSPGLHLVTVVAENALGAVDAAVGVAVQVPVAG
LSIQAGEPEGSFVAVGATVPFWGQLAAGSNVSWSWAVPGGSTLQGQHVAVTFPEAGTFSV
QLNASNAVSWAVAGHSLTAEEPVLGLALWASSKVVEPGQLVDFRVLQAAGSGVALRLQVS
GAEPEMLAGPRFSRSFPRAGDYVVTVQAENHVSRAQAQVRVAVLEPVGGLWLPRCCAQAV
PTGAEQNFTARVHRGSRVQYAWYFSLQKVQGDSLVILSGRDVTYTPVAAGLLEVQVRAFN
ELGGANLTRWLEVQDVIQQVVLRSTHCFVNRSARFEAATSPSPRWVVFHWDFGDGAPVQM
TADPWATHTYLQPGDYRVQANASNLVSFLVAQTAVVVRVLACEEPRVDVALPPQVLMRRS
QRNYLEAHVDLRGCITYQTEYLWEVYRASSCRRPGRATRLALPGVDVSRPQLVVPRLALP
VGHYCFVFVVSFGDTPLARSIQANVTVVPERLVPIIEGGSYRVWSDTRDLVLDGSRSYDP
NLEDGDQTPLSFHWACAVTSQSEAGGCVLNFGPRGSPVVTIPRERLEAGVEYTFELTVWK
AGRKEEVANQTVLIRSGRVPIVSLECVSCKAQAVYEVSRSSHLYLEGRCLNCSRGSKRGR
WAARTFSNQTLVLDETTTSTGSEGMRLVVRRGALRDGEGYTFTLTVLGRSGEEEGCASIR
LAPNRPPLGGSCRLFPLDGVQALVTKVHFECAGWRDAEDAEAPLLYTLWLRRCRQGHCEE
FCVYKGSLPAHGAVLPPGFPPHFTVGLAVLVQDQLGVAVVAFNRSLAIPPPEPPNGPGGL
TRWLHSLTESRLRGLLRQADPQHVIEHSLALVTVLNEHEQSPAAAADSTLERQLRAEMRR
TITETLVSLRVDTVDDIQQIAAALAQCTVSSRELVCEPCLKKTLHKLEAMMRVLQAETTE
GTETPTAIADSILNITGDLIHLASTDAPSPAPGEPAVPGVARPSLLVASRAYNLSSALMQ
ILMRSRVLNEEPLTLAGEEIVAQGKRSDPLSLLCAGRAPGPDCHFLIPAAFSGVLAGRSD
VVQLIFLVDSNPFPFGYISNYTVSTKVASMAFQTQAGAQIPIEQLASERAITVMVPSNTG
PAGPGHSVPAAATTIVPPRASVGAQVAPESSNPAAGLHLQLTFTVLDETYLSEEPEPYLA
VYLEPQPHEHNCSASRRVSLRALAGEDHRPYTFFIAPGTREPGGSYHLNLTSHFRWSALR
ASVGLYASLCQYFSEEDMAWRTEGIEALEETSPRQAVCLTRHLTAFGASLLVPPTRVTFV
ISEPAAGVNYVVPLTCAVCLVTYVVMIAVLRKLDQLDMRRVRVIPFCGKGGRFKYEILVK
TGWGRGSGTTAHVGIMLYGVDSRSGHRHLDGDGAFHRNSLDVFQIATPRSLGRLWKIRVW
HDNKGPSPSCLPRPVALGARXXXXXXXXXXXXXXXXXXXXXGGPNGGLVEKEVRAASDAL
RQFRRLLVAELQRGFSDQHIWLSLWDRPPRSRFTRVQRATCCVLLLCLFLGANAVWYGVV
GDSAHSTQLVSSLIPLSADTVTVGLVSSVVVYPIYLVLLFLFRMSRSQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXFSRLRAEQVFAEQIRNDLFLDDSKSLVYWPSSEGSLSWPD
LLSDPSIMGNALQQLARGLPGRTLGLEEDGLSLISPSSPAKCFSAPDEDLVCQILAEGAS
SLAPTQDFQVETDLLTSLSGAPGERTEALTLHRLGEKGPPAPGLGWDEPSSARHCHTGLA
EGPRRRLLPAWCAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVMLEALYFSLVAKRLHPDEDDTLVESPAVTPVSERVPRVRPPQGFALFLAKEEAR
KVKRLHRALQNLLVYMLFLLVTLLANYGDASYRGHAYRLQSAIKQELDSQGFLAITGSDK
FWPWMSHVLLPYVHGNQSCPELGPPRLRQVRLQEALCPDPLGSGPHPCSATAGFSTSDYG
VGWQHATHNSSGTWAYSAPDLLGFWHWGTCAVYDSGGYVQELGSSLEDSRARLDFLQQHH
WVDNRSRALFVELTHCSPAVRLHAAITLRLEFPVAGQAVASLSIHPFTLQRFSSGLSLQL
LTSVTLLLFALYFLVAEAQVCRREGCRRVARPGAWVRGLLAVLAAAAALVRLAQLGAADR
QWARLVGGPPHHFISFEQVAQLGMVARGLAASLLFVLLMKAAQQLRFVRQWSVFGKTLCR
ALPELVGAAVALVVLAVAYTQLAVLLVSSGADSLRSAAWALLVLCPGTGGPALCPAEPWR
LSPLLCTGLWALRLWGALRLGAVLLRWHYHALRGELYRPAWEPQDHEMVELLLRRLRLWM
GYGKAKEFRHKVRFEGMEPLPSRSSRDSKSSRDVPPPSAGSDASRPPSSTSSQLDVGMAR
PGPRGEPEPSRIDAVFEALLTQFDRLNQ
Download sequence
Identical sequences ENSPCAP00000003596 ENSPCAP00000003596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]