SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003802 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003802
Domain Number 1 Region: 19-291
Classification Level Classification E-value
Superfamily L domain-like 1.15e-61
Family Ngr ectodomain-like 0.000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003802   Gene: ENSPCAG00000004101   Transcript: ENSPCAT00000004052
Sequence length 321
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6864:14296:27254:1 gene:ENSPCAG00000004101 transcript:ENSPCAT00000004052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLALPPSTQRLFLQNNL
IRTLRPGTFGPHLQTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPNTFQGLE
RLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRL
RLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFRGLSRLTILYLFNNSLASLPGEALADLP
SLEFLRLNANPWACDCRARPLWAWFQHARVSSSDVTCATPPERQGRDLRALREADFQACP
PAVPTRPGSRARGNSSSNHLY
Download sequence
Identical sequences ENSPCAP00000003802 ENSPCAP00000003802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]