SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003877 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003877
Domain Number 1 Region: 24-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000785
Family Growth factor receptor domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003877   Gene: ENSPCAG00000004181   Transcript: ENSPCAT00000004133
Sequence length 184
Comment pep:known_by_projection scaffold:proCap1:scaffold_3475:50906:57890:1 gene:ENSPCAG00000004181 transcript:ENSPCAT00000004133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLWLLTALLVPVHLVTAWSAKYAVDCPDRCDSNNCKISPRCKRMVLDDCGCCRVCAAG
LGETCYRTVSGMDGVKCGPGLRCQFYSEEDDFGDEFGICKDCPYGTFGMECKETCTCSSG
ICDRETGKCLKFPFFQYSVAKSSNRRFVSHTEHHVASGDGNAVREEIVKEAAARSPVMKW
LNPR
Download sequence
Identical sequences ENSPCAP00000003877 ENSPCAP00000003877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]