SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004030 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004030
Domain Number 1 Region: 24-245
Classification Level Classification E-value
Superfamily L domain-like 4.42e-30
Family Internalin LRR domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004030   Gene: ENSPCAG00000004292   Transcript: ENSPCAT00000004295
Sequence length 858
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6539:4039:37890:1 gene:ENSPCAG00000004292 transcript:ENSPCAT00000004295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVARVDAASPPGEGSVVNWSGQGLQKLGPNLNCEADIHTLILDKNQIIKLENLEKCRQL
IQLSVANNRLVRMMGVAKLTQLRVLNLPHNSIGYVEGLKELVHLEWLNLAGNNLKAMEQI
NCCTALQHLDLSDNNIPQIGDLSKLLSLKTLLLHGNIITSLRMAPPYLPRNLAILSLAEN
EIRDLNEISFLASLTELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQ
KESLKAEWLYSQGKGRAYRPGHHIQLAQYLATVCPLTSIAGLQTAEDAKLEKILSKQRFH
QRQLMNQSQNEELSPLAPIETRSSLVPVHSSPVQDCQIVQESEPITQVNSWVGISNKDDQ
LCAVKNNFLPSVHTTRYSRNDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPVSPTVE
LRLQGINLDLQYDVIADQSVKKLENQDLSKKEEKLLWSAHENSVKIMQSEMSAEINEKAG
LLPCLEPVITSSVLKDDNCSLTSFPQSFDTVSHTQPENGETISPTALEKLPCRISTGRSV
ALVQDKVALHKLNEAATKLQACWRGFYARNYSPQVKDVRYEIRLRRMQDHIVCLTDEIQR
LRKERDEERIKKNVQEEAVRFLWNQVRSLQAWQQTMDQRLSSWHADVPTSSTVVSPNPAL
FIHTQEPSSDQNSDQFIAPDEGPQEKSLPAFPDSGFHSSLTEQIHGLQESLEFEQSSTEG
SENSIMGNSIDTVKCGRESDLGDAREEKGDWSQESLNNEQDNSLLEQYLTSVQQLEDADE
RTNLGEGIGDNELHTACSPEKLEALSDSASVGDTRGLSPPVQDEISQIPENCKLSAEVQG
QQSECESTFQVLNVGITV
Download sequence
Identical sequences ENSPCAP00000004030 ENSPCAP00000004030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]