SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004347 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004347
Domain Number 1 Region: 141-202
Classification Level Classification E-value
Superfamily L domain-like 0.000000816
Family Ngr ectodomain-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004347   Gene: ENSPCAG00000004662   Transcript: ENSPCAT00000004636
Sequence length 297
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7235:84346:92753:-1 gene:ENSPCAG00000004662 transcript:ENSPCAT00000004636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLQQSILLLLFVPLIKPAPPTHQDLHSIYDYGIDNFEETVFSQDYEDKYLDGKNIKEK
ESIIIPDKKSLQLQKDESVTTSLPKKENEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNLRRLDFTGNLIQEIEDSTFSLLLLEELSLAENQLLK
LPVLPPKLTLFNAKYNKIKSRGIKANTFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XFNNITSITDDTFCKADDARYIRDRMEEIRLEGNPIILGKYPNSFTCLKKLPVGSYF
Download sequence
Identical sequences ENSPCAP00000004347 ENSPCAP00000004347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]