SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004438 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004438
Domain Number 1 Region: 329-568
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 2 Region: 149-278
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-28
Family YWTD domain 0.0000331
Further Details:      
 
Domain Number 3 Region: 1068-1192
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-16
Family YWTD domain 0.00079
Further Details:      
 
Domain Number 4 Region: 1323-1361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 1244-1284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 585-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000162
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 7 Region: 1285-1322
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 8 Region: 281-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000733
Family EGF-type module 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000004438
Domain Number - Region: 630-680
Classification Level Classification E-value
Superfamily YWTD domain 0.000314
Family YWTD domain 0.0027
Further Details:      
 
Domain Number - Region: 962-996
Classification Level Classification E-value
Superfamily YWTD domain 0.0157
Family YWTD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004438   Gene: ENSPCAG00000004688   Transcript: ENSPCAT00000004734
Sequence length 1611
Comment pep:novel genescaffold:proCap1:GeneScaffold_591:11644:118949:-1 gene:ENSPCAG00000004688 transcript:ENSPCAT00000004734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLIDATNGENATIVVGGLEDAAADFVFGH
GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXFMYWTDWGEVPKIERAGMDGSSRYIIINTEIY
WPNGLTLDYAERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDW
NTHSILACNKYTGKGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPV
TPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHA
IAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDT
GTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRV
VLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMSTDGTGRRVLVEDKIPHIFGFTLLG
DYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCSHL
CLYRPQGLRCACPIGFELITDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVK
EASALDFDVTDNRIYWTDISLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
SLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYMYFTNLQERSPK
IERAALDGTEREVLFFSGLSKPIALALDSKLGKLFWADSDLRRIESSDLSGANRIVLEDS
NILQPVGLTVFENWLYWIDKQQQMIEKIDMMGREGRTKVQARIAQLSDIHAVKELNLHEY
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPTCSPQQFTCFTGEID
CIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNC
EVLCLIDQFRCASGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIV
TIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPXXXXX
XXXXXXXXXXGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEF
GYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNY
DSEPVPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSPCAP00000004438 ENSPCAP00000004438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]