SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004497 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004497
Domain Number 1 Region: 475-825
Classification Level Classification E-value
Superfamily L domain-like 4.17e-53
Family Internalin LRR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004497   Gene: ENSPCAG00000004851   Transcript: ENSPCAT00000004798
Sequence length 858
Comment pep:known_by_projection scaffold:proCap1:scaffold_3186:20115:22691:-1 gene:ENSPCAG00000004851 transcript:ENSPCAT00000004798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTLAEVASLNDIQPTYRILKPWWDVFMDYLAVVMLMVAIFAGTMQLTKDQVVCLPVLPS
PVNSKAHMPPGNADVTTDIPKIEAATDRDLDGRATNDVSLGTSAVTPDIPLRATYPRTDP
SVPSQEARKEKIDPTGRKTNLDFQQYVFINQMCYHLALPWYSKYFPYLALIHTIILMVSS
NFWFKYPKTCSKVEHFVSILGKCFESPWTTKALSETACEDSEENKQRITGAQTLPKHVST
SSDEGSPSASTPMINKTGFKFSAEKPVIEVPSMTILDKKDGEQAKALFEKVRKFRAHVED
SDLIYKLYVVQTVIKTAKFIFILCYTANFVNAISFEHVCMPKVEHLTGYEVFECTHNMAY
MLKKLLISYISIICVYGFICLYTLFWLFRIPLKEYSFEKVREESSFSDIPDVKNDFAFLL
HMVDQYDQLYSKRFGVFLSEVSENKLREISLNHEWTFEKLRQHVSRNAQDKQELHLFMLS
GVPDAVFDLTDLDVLKLELIPEAKIPAKISQMSNLQELHLCHCPAKVEQTAFSFLRDHLR
CLHVKFTDVAEIPAWVYLLKNLRELYLVGNLNSENNKMIGLESLRELRHLKILHVKSNLT
KVPSNITDVAPHLTKLVIHNDGTKLLVLNSLKKMMNVAELELQNCELERIPHAIFSLSNL
QELDLKSNSIRTIEEIISFQHLKRLTCLKLWHNKIVTIPPSITHVKNLESLYFSNNKLES
LPVAVFSLQKLRCLDVSYNNISVIPVEIGLLQNLQHLHITGNKVDVLPKQLFKCVKLRTL
NLGQNCITSLPEKIGQLSQLTQLELKGNCLDRLPAQLGQCRLLKKSGLVVEDHLFDTLPL
EVKEALNQDINVPFANGI
Download sequence
Identical sequences ENSPCAP00000004497 ENSPCAP00000004497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]