SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004641 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004641
Domain Number 1 Region: 62-345
Classification Level Classification E-value
Superfamily L domain-like 7.78e-41
Family Ngr ectodomain-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004641   Gene: ENSPCAG00000005013   Transcript: ENSPCAT00000004953
Sequence length 421
Comment pep:known_by_projection scaffold:proCap1:scaffold_36907:9383:10648:1 gene:ENSPCAG00000005013 transcript:ENSPCAT00000004953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGCSRSPAAGDGRLRLARLALVLLGWVSSSSLTSSASSSDSSASSSLASAVSTQPPLP
GHCPPPCECSAAARTVKCVNRNLTTVPADLPPYVRNLFLTGNWLAELPAGAFARRPPLAE
LATLNLSGSHLEEVRAGAFEHLPSLRQLDLSHNPLAHISPFAFSGSNASVSAPSPLVELM
LNHILPPGDEKHNRSFEVMVAAALRAGQALRELHRLELASNHFLYLPRDVLPQLPSLRHL
DLHNNSLVSLTYVSFRNLTYLESLHLEDNALKVLHNGTLAELQGLPHVRVFLDNNPWVCD
CHMTDMVAWLKETDVVQGKTRLTCAFPEKMKDRFLLQLNTSDLDCDPILPPSLQTSYVFL
GIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSD
V
Download sequence
Identical sequences ENSPCAP00000004641 ENSPCAP00000004641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]