SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004848 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004848
Domain Number 1 Region: 50-225
Classification Level Classification E-value
Superfamily L domain-like 4.42e-33
Family Internalin LRR domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004848   Gene: ENSPCAG00000005245   Transcript: ENSPCAT00000005177
Sequence length 225
Comment pep:known_by_projection scaffold:proCap1:scaffold_50101:442:1116:1 gene:ENSPCAG00000005245 transcript:ENSPCAT00000005177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAKPSRADHKDKNPKKMLLLGRRQKLSLWDDAFLPGRDPRSLLKHGMSHVSFSLVTKGM
TDVPDFLWGLSEVQKLNLSHNKLRILSPEVGRLTQIVVLNLCGNHLKSLPGELSLLKSMK
VLFVNMNHLTEMPAELSTCKHLEVLSLSHNRLSQLPTSFADLSRLKKLNLSNNLFVQIPI
CVFSLKELDFLHVGSNRLENIAESIQCLASLQIFIAESNNIHSFP
Download sequence
Identical sequences ENSPCAP00000004848 ENSPCAP00000004848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]