SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004910 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004910
Domain Number 1 Region: 634-780
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 7.19e-46
Family Toll/Interleukin receptor TIR domain 0.000000152
Further Details:      
 
Domain Number 2 Region: 338-586
Classification Level Classification E-value
Superfamily L domain-like 6.46e-32
Family Internalin LRR domain 0.06
Further Details:      
 
Domain Number 3 Region: 29-177,232-292
Classification Level Classification E-value
Superfamily L domain-like 9.07e-22
Family Ngr ectodomain-like 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000004910
Domain Number - Region: 570-628
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0929
Family ABC transporter transmembrane region 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004910   Gene: ENSPCAG00000005314   Transcript: ENSPCAT00000005241
Sequence length 788
Comment pep:known_by_projection scaffold:proCap1:scaffold_17969:15476:17842:1 gene:ENSPCAG00000005314 transcript:ENSPCAT00000005241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKVNSSIFYFAIIFNSILNIRSQLSEESGLVIDRSKMNLTCIPKELPLKTTILDASQNY
ITELQASDISSLSKLRILILSHNRIQYLDISAFKFNRELEYLDLSHNKLWKISCHPTVNL
KHLDLSFNEFDVLPLCKEFGNMSQLAFLGLSATQLQKSSVQPIAHLMISKVLLVLGELYG
QKEDPESLQDLNTKSLHIVFPSKKEFHFVLDVAASTAVSLELSNIKYVPDNNEYSSFIQV
LLKLQKNPRLLRLALNNIETTWNSFIDIIQLVCYTTVEYFLISNVKLTGNLDHDSFDYSS
TSLKALSIHQVFSNVSYLDQDRVYNIFSNMKIQNFTVTDTRMIHMSCPLQISPFVYLNFS
NNLLTDTVFKDCKRLTSLKTLILQRNQLKELAKIVDTTKGMTSLQQLDISQNSVRYENEG
YCIWTKSLLILNMSSNILTDTVFRCLPPRVTVLDLHNNKIVSIPKDVTSLEALEELNVAS
NYLTDLPGCGTLSSLSVLIIDYNLVSHPSADFFYSCQKIRSIKAGNNPFQCSCKLREFIK
NIGQISSEVVEDWPESYKCAYPENSKGILLQDFHISPLSCSTTLLIATIGIPMLALVVIV
TFLCIYFDLLWYLRMVCRWTQTRYRARNLPLEELQRNLQFHAFISYSGQDSAWVKSELLP
NLEKEDMQICLHERNFIPGKSIVENIINFIEKSYKTIFVLSPNFVQSEWCHYELYFAHHK
LFQDASYNLILILLEPIPQYSIPSKYHKLKTLLAQRTYLEWPKEKNKHGLFWANLRATIN
IKLIEQDE
Download sequence
Identical sequences ENSPCAP00000004910 ENSPCAP00000004910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]