SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004933 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004933
Domain Number 1 Region: 48-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000596
Family HkH motif-containing C2H2 finger 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004933   Gene: ENSPCAG00000005336   Transcript: ENSPCAT00000005265
Sequence length 156
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3842:18791:19494:1 gene:ENSPCAG00000005336 transcript:ENSPCAT00000005265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRSRRTGAHRAHSLARQMKAKRRRPDLDEVHQELQPPGPTRSLRNQGADPDPDLPGCGL
HRCLACARYFIDSANLRTHFRSKDHKKRYGGVRKRLIDDCWAGRLRICSAPNFCPFTSQA
EAADRGALQSGRGREGSGHGFLCAPQAATSPHRGVH
Download sequence
Identical sequences ENSPCAP00000004933 ENSPCAP00000004933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]