SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005068 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005068
Domain Number 1 Region: 708-976
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.68e-67
Family Protein kinases, catalytic subunit 0.0000000272
Further Details:      
 
Domain Number 2 Region: 28-204
Classification Level Classification E-value
Superfamily L domain-like 1.33e-44
Family L domain 0.000000256
Further Details:      
 
Domain Number 3 Region: 322-493
Classification Level Classification E-value
Superfamily L domain-like 1.08e-43
Family L domain 0.0000000576
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000005068
Domain Number - Region: 292-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0863
Family Growth factor receptor domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005068   Gene: ENSPCAG00000005292   Transcript: ENSPCAT00000005419
Sequence length 1341
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_502:7390:27330:1 gene:ENSPCAG00000005292 transcript:ENSPCAT00000005419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTKGALQVLGFLLSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYNRCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQIYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILSGGVYIERNEKLCHMDTIDWRDIVRQPEAEIVVKENG
KSCPPCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
IDCIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFVVDQAS
CVRACPADKMEVDKNGLKMCEPCGGLCPKACEGTGSGSHFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIEG
RSLYNRGFSLLIMKNLNITSLGLRSLKEISAGRIYISSNRQLCYHHSLNWTKLLRGPAEE
RLDIKHNRPRRDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXCKGPTLQDCLDQIPVPISKTHLAMALALVAGLLMIFLIVG
STFLYWRGRQIQKKRAMRRYLERGESLEPLDPREKANKVLARIFKDTELRRLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDSGRQFQAVTDHMRAIGSLDHAHIVRLLGLCPGSY
LQLVTQYLPLGSLLDYVRQHRGVLGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLL
KSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVW
ELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELA
NEFTRMARDPPRYLVIKRESGPGISPGAEPPALTNKELEEVELEPELDLDLELEAEEDDL
ATTLGSALSLPVGTLPRPHESQSLLSPSSGYMPMNQGNLGEAYQEFAVSGDSERCPRPAT
LHPVSWRHLMSESSEGHVTGSEAEFQEKASMCRSRSRSRSRSPRPCGDSAYHSQRHSLLT
PVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEEEEYEYMN
RRRRRSPPRPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDYE
YMNRRRGGGDPGGDYASMGACSAAEQGYEEMRAFRGPGHQSPNVHYTRLKSLRSLEATDS
AFDNPDYWHSRLFPKTSAQRT
Download sequence
Identical sequences ENSPCAP00000005068 ENSPCAP00000005068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]