SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005537 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005537
Domain Number 1 Region: 120-439
Classification Level Classification E-value
Superfamily L domain-like 7.82e-59
Family Internalin LRR domain 0.0097
Further Details:      
 
Domain Number 2 Region: 689-784
Classification Level Classification E-value
Superfamily Immunoglobulin 3.18e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 602-700
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-20
Family I set domains 0.0071
Further Details:      
 
Domain Number 4 Region: 497-606
Classification Level Classification E-value
Superfamily Immunoglobulin 1.43e-17
Family I set domains 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000005537
Domain Number - Region: 45-114
Classification Level Classification E-value
Superfamily L domain-like 0.00884
Family Ngr ectodomain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005537   Gene: ENSPCAG00000005872   Transcript: ENSPCAT00000005929
Sequence length 1062
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7312:4181:53551:1 gene:ENSPCAG00000005872 transcript:ENSPCAT00000005929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAPQGVQEELLLGSRSGPLLRLLFLTQAGLLLLPAAWAGLCPAPCSCRLALLDCSRKK
LPAPSWRTLSGPLPPDTSSLDLSHNRLSNWNVSLESQTLQEVKMNYNELTEIPYFGEPAS
NITLLSLVHNIIPEIHAEALQFYPALESLDLSSNVISEIKASSFPRMQLKYLNLSNNRIT
TLEAGCFDNLSSSLLVVKLNRNRISMIPPKIFKLPHLQFLELKRNRIKTVEGLTFQGLDS
LRSLKMQRNGISRLKDGAFFGLDNMEELELEHNNLTEVNKGWLYGLRMLQQLYVSQNAIE
RISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRITHIADGVFRFLSN
LQTLDLRNNEISWAIEDASDAFAGLTSLTKLILQGNQIKSVTKKAFTGLGSLEHLDLNNN
AVMSIQENAFSQTHLKELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXDFLKPQIRTHPETTIALRGVNVTLTCAAVSSSDSPTSALWRKDSEVL
YDADIENFVRYQQQAGEALEYTSVLHLFNVNFTDEGKYQCIVTNHFGSNYSQKAKLTVNE
MPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVMPEDDVF
FIANVKIEDMGIYSCMAQNIAGGLSANASLTVLETPSFIRPLEDKTVTRGETAVLQCIAG
GSPAPRLNWTKDDGPLLVTERHFFAAANQLLIIVDAGLEDAGKYTCIMSNTLGTERGHIY
LNVITSPNCDSSQSSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVIYHMRRKNEDYSI
TNTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPASGYIHRGADGDGTRVI
CSDCYDNANIYRTREYCPYYITEEDDLDQTLSSLMIQMPKETYLAHPPQDATTLESVIAS
ADRELSVFPTNHERINEKKLPSAQLSNETSQRPLWSVNKELGLPHPACLQHPILESTQRL
RNEGLADNDPDCSASPVPCHRLYDHSFEFSRTQNLQDGSEGT
Download sequence
Identical sequences ENSPCAP00000005537 ENSPCAP00000005537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]