SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005598 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005598
Domain Number 1 Region: 276-389
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-35
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 2 Region: 121-229
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-34
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 3 Region: 441-554
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.09e-27
Family Frizzled cysteine-rich domain 0.00034
Further Details:      
 
Domain Number 4 Region: 234-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 396-440
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005598   Gene: ENSPCAG00000006001   Transcript: ENSPCAT00000005996
Sequence length 556
Comment pep:novel scaffold:proCap1:scaffold_11150:8:5426:1 gene:ENSPCAG00000006001 transcript:ENSPCAT00000005996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAFEAESGSPCPLPLLSQEDANHSLQDPWHGRHPRGLQPDCHFSWFCVLLLTGLLLLLLG
LLVTIILAQLQATPPSTTSYSPLLSQGLGTTTRTTLTTSQATGTSQRQQEAGMSPTPQST
CGGLLFGPKGFFSSPNYPDPYPPNARCMWHIQVAPGHTIQLKIDILSVESVASCLFDRLE
ISEPEGPLLRVCGRVPPPTLNINASHLWVVFTSDSSVEGLGFHAWYQAVATGKGSCASDE
FPCDQLLCLLPNSVCDGFANCADGSDEANCSTKSPGCGGNLTGLQGTFSAPKQPRLYPYQ
QLCTWHISVPPGHHIELQFHNFSLEVQDECKLDYVEVYETSNSGAFSLLGRFCGEEPPPR
LISSYHKLAVLFRTDHGISSRGFSATYQALNATENPCQPRVFSCQDGVCKDVQWMCDMWR
DCTDSGNDNNCSSPLFPLPELACEPVQVEMCLGLSYNTTAFPNIWVGMATQLEVVEVLNG
YKSLKSLPCYQNFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFN
CNRLPEAAGLEVCAQP
Download sequence
Identical sequences ENSPCAP00000005598 ENSPCAP00000005598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]