SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005717 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005717
Domain Number 1 Region: 15-146
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000578
Family U2A'-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005717   Gene: ENSPCAG00000006106   Transcript: ENSPCAT00000006122
Sequence length 463
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4835:9429:27804:1 gene:ENSPCAG00000006106 transcript:ENSPCAT00000006122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISCLCAHPPPGLQHLGVGHNKLLGPLESLYVTSDHVFVLPVFSELKSVGFLVCGNRVLAC
WGGQAPGFPVPRWPRSPFRPNLVSLDLSFNDLTDPQRMVDSLRSLRHLRLLVLQGNPLAL
VPYYRGLTVDTLSRLCVLDDITVSPNEKHQFRGLSMNKDLLVQEAQLVVTIGNTTGILDS
SVLDPEPGPEGPFITYSYYVTYDFVEDEASAGSEYSGVLAEIIQPWPSTEVMPEDSVEEE
CIEEVEESAESAGMTDSGEGSISAGDSAVLPRSIDSGEELAKLRPRIDSAPSLSPGTVLF
STARKPWSDVISWNYEMQHTLQDLVPLKAFLLAGTTVTIVQEKIVSWPVVPCPSEIPSAI
KKGKGKDDKKGKEDDKIGMGEKEASKEQKEPKKKKELPKELRQDPPILTVLGKGMVVLES
LLAGESLVSTVCNFGVVRTVESDKLTFARDSKKTKPKKKEVKR
Download sequence
Identical sequences ENSPCAP00000005717 ENSPCAP00000005717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]