SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005882 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005882
Domain Number 1 Region: 36-291
Classification Level Classification E-value
Superfamily L domain-like 1.75e-46
Family Ngr ectodomain-like 0.037
Further Details:      
 
Domain Number 2 Region: 284-379
Classification Level Classification E-value
Superfamily Immunoglobulin 8.13e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 422-495
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000543
Family Fibronectin type III 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005882   Gene: ENSPCAG00000006347   Transcript: ENSPCAT00000006294
Sequence length 719
Comment pep:known_by_projection scaffold:proCap1:scaffold_3807:14854:30816:1 gene:ENSPCAG00000006347 transcript:ENSPCAT00000006294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFLLYLFLIGIAVRAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDH
NMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPTLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLE
GQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIAS
NPAGEATQTVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNASSSNGDTKISQDK
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKPFLVNNLAAGT
MYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVAS
VLVFIIILMIRYKVCNNNEQHKVTKVSNVYSQTNGAQMQGCSVTLPQSLSKQAVGHEENA
QCCKVANDSVAQPSETCSSHDSSTTTSALPPTWTSSTSVLQKQKRKTGTKPGTEPQSEAI
TNAESQNTNRNNSTALQLASRPPDSVTEGPTSKRAQSKPNASLTNVDQTVQETQRLELI
Download sequence
Identical sequences ENSPCAP00000005882 ENSPCAP00000005882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]