SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005909 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005909
Domain Number 1 Region: 19-86
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000998
Family Internalin LRR domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000005909
Domain Number - Region: 321-383
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.0555
Family Nuclear movement domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005909   Gene: ENSPCAG00000006340   Transcript: ENSPCAT00000006322
Sequence length 468
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2896:11303:50292:-1 gene:ENSPCAG00000006340 transcript:ENSPCAT00000006322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRITEELIRRNAEHNDCVIFSLEELSLHQQGIEKLEHIDRWCRELKILYLQNNLIGKIE
NVSKLKKLEYLNLALNNIEKIENLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXWLDGKEIERSERIQALQDYPVIEQQIREQERAYRRQR
ARDKEEARRKLEEEQGKQEKRSNPGFDRRRYTDVNTTLXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKNKKAKPPRTLITEDGKVLN
VNEPKLDFSLKDDEKHNQIVLDLAVYRYMDTSLIDVDVQTTYVRVIVKGKPFQLVLPAEV
KPDGSSAQRSQTTGHLVIRMPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKQIEKLEV
DPSKHSFPDVANIVQEKKHIPRGRAEPKYVPSDDAADFEDNPDVPPLI
Download sequence
Identical sequences ENSPCAP00000005909 ENSPCAP00000005909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]