SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005956 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005956
Domain Number 1 Region: 22-107
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000697
Family U2A'-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005956   Gene: ENSPCAG00000006413   Transcript: ENSPCAT00000006371
Sequence length 190
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4268:4910:174224:1 gene:ENSPCAG00000006413 transcript:ENSPCAT00000006371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSYIGQDCREIPEYLGRDCGHFAKRLDLSFNLLRSLEGLNAFHSLEELIVDNNLLGDDLV
LPRLPRLHTLTLNKNPITDLQCLLDNLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYK
RYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASSEDAAASPEHHYTPLP
SGSRELTSHR
Download sequence
Identical sequences ENSPCAP00000005956 ENSPCAP00000005956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]