SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005960 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005960
Domain Number 1 Region: 708-990
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-57
Family Protein kinases, catalytic subunit 0.00000000192
Further Details:      
 
Domain Number 2 Region: 328-520
Classification Level Classification E-value
Superfamily L domain-like 7.09e-45
Family L domain 0.000000317
Further Details:      
 
Domain Number 3 Region: 505-636
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-24
Family Growth factor receptor domain 0.000000116
Further Details:      
 
Domain Number 4 Region: 186-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.75e-19
Family Growth factor receptor domain 0.0000000249
Further Details:      
 
Domain Number 5 Region: 141-209
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000822
Family L domain 0.001
Further Details:      
 
Domain Number 6 Region: 27-80
Classification Level Classification E-value
Superfamily L domain-like 0.00000000162
Family L domain 0.0000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005960   Gene: ENSPCAG00000006282   Transcript: ENSPCAT00000006375
Sequence length 1210
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4140:14192:173180:1 gene:ENSPCAG00000006282 transcript:ENSPCAT00000006375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPFGAAGATLLLLLATHFQASWALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQKNYDLSFLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXILSGAVRFSNNPVLCNVETIQWRDIVDSDFISNMSLDF
QSSLAKCQKCDPSCPNGSCWSVGQENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLICRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPHNYV
VTDHGSCVRSCGSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFKGDSFTHTPPLDPKELDILKTVKEITEFLLIQAWPANKTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLHITSLGLRSLKEISDGDVIISGNQKLCYANTIKWKKL
FGTSRQNTKITNNRGEKDCKTMGHVCHPLCSSEGCWGPEPEDCVSCLNVSRGRECVNKCN
ILEGEPREFVEKSECIQCHPECLPQIMNITCTGRGPDNCIKCAHYIDGPHCVKTCPAGIL
GENNTLVWKYADANHVCHLCHSNCTFGCAGPGLEGCAMNGPKIPSIATGIVGGLFLLVVV
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPVTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQXXXXXXXXSPTDSNFYRALMDEEDIEDVVDADEYLIPQ
QGFFNSPSTSRTPLLSSLSATSNNSTVACIDRNGQQSCPIKEDSFLQRYSSDPTGALTED
SIDDSFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQNPHSNAVENPEYLN
TIQPACVSNVSDSPANWAETGNHQISLDNPDYQQDFLPKEAKPNGIFKVPAAENAEYLRV
APPSSEFIGA
Download sequence
Identical sequences ENSPCAP00000005960 ENSPCAP00000005960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]