SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005970 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005970
Domain Number 1 Region: 41-217
Classification Level Classification E-value
Superfamily L domain-like 4.08e-36
Family Ngr ectodomain-like 0.0057
Further Details:      
 
Domain Number 2 Region: 265-435
Classification Level Classification E-value
Superfamily L domain-like 1.36e-25
Family Ngr ectodomain-like 0.041
Further Details:      
 
Domain Number 3 Region: 686-781
Classification Level Classification E-value
Superfamily Immunoglobulin 3.57e-24
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 599-696
Classification Level Classification E-value
Superfamily Immunoglobulin 3.2e-22
Family I set domains 0.0073
Further Details:      
 
Domain Number 5 Region: 494-601
Classification Level Classification E-value
Superfamily Immunoglobulin 9.08e-18
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005970   Gene: ENSPCAG00000006335   Transcript: ENSPCAT00000006386
Sequence length 1091
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4009:112280:260462:-1 gene:ENSPCAG00000006335 transcript:ENSPCAT00000006386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPAPGVLGAPQRSPGLLLLWLLLLRPEPATATAVPRASCAAACTCAGDSLDCGGRGLT
TLPRDLPVWTRNLNLSYNKLSEVDPADFENLPDLQEVYLSNNQLTAIPSLGAASSHIVSL
FLQHNKIRSVEGSQLKAYLSLEVLDLSSNDITEIRSTCFPPGLHIKELNLVSNRIGTLES
GAFDGLSRSLLTLRLSKNRITQLPVKAFKLPRLTQLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXHLEYNSLMEVNSGSLYGLTALHQLHLSNNSISRINR
DGWSFCQQLHELILSFNNLSRLDEESLADLSSLNILRLSHNSISHIAEGAFKGLKSLRVL
DLDHNEISGTIEDTSGAFTGLDSLSKLXXXXXXXXXXXXXXXXXXXXXXXXNLGENAIRS
VQFDAFVKMKNLKELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXDFPKPQIITQPETTMAVLGKDIQFTCSAASSSSSPMTFAWKKDNEVLANA
DMENFAHVRAQDGEVMEYTTILHLRHVTFGHEGRYQCIITNHFGSTYSHKARLTVNVLPS
FTKTPHDIAIRTGTMARLECAARGHPNPQIAWQKDGGTDFPAARERRMHVMPDDDVFFIT
DVKVDDMGVYSCTAQNTAGSVSANATLTVLETPSLVVPLEDCVVSVGETVALQCKATGSP
PPRITWLKGDQPLGLTERHHFTPGNQLLVVQNVVAEDAGRYTCEMSNALGTERAHSQLSV
LPTPGCRKDGTSVGIFTIAVVCSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETIVPPDVP
SYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDAGLSPEVDAYGVACIQPKLCVG
YNKEPWKVTEKADRTPGPHKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSS
WTLARLCEPDSLDPQPPSALTSGDPELTEAQHLLPSSGHLHKACDSSPESTPVTGQLPGK
QSVPLLSAPQV
Download sequence
Identical sequences ENSPCAP00000005970 ENSPCAP00000005970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]