SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006065 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006065
Domain Number 1 Region: 713-954
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-70
Family Protein kinases, catalytic subunit 0.00000000303
Further Details:      
 
Domain Number 2 Region: 335-523
Classification Level Classification E-value
Superfamily L domain-like 2.67e-41
Family L domain 0.000000398
Further Details:      
 
Domain Number 3 Region: 46-213
Classification Level Classification E-value
Superfamily L domain-like 5.39e-39
Family L domain 0.000000905
Further Details:      
 
Domain Number 4 Region: 509-640
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.14e-21
Family Growth factor receptor domain 0.000000312
Further Details:      
 
Domain Number 5 Region: 189-341
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000628
Family Growth factor receptor domain 0.000000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006065   Gene: ENSPCAG00000006412   Transcript: ENSPCAT00000006488
Sequence length 1250
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3795:2558:24361:1 gene:ENSPCAG00000006412 transcript:ENSPCAT00000006488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELAWCRWGLLXXXXXXXXXXXXXCTGTDMKLRLPASLETHLDMLRHLYQGCQVVQGNLE
LTYLPADASLSFLQDIQEVQGYVLIAHNQVRQVPLHRLRIVRGTQLFQDKFALAVLDNGD
PLGHVSPATGAVPGGLQELQLRSLTEILKGGVMIQRNPQLCYQETVLWKDIFHKNNGLSL
ELVDTNHSRPCRPCSPACKVPHCWGESSEDCQSLTRTVCASGCARCKGPLPTDCCHEQCA
AGCTGPKHSDCLACLHFNHSGICELHCPPLVVYNTDAFESENPEGRYTFGASCVVTCPYN
YLSTDVGSCTLVCPLNNQEVTAQDGTQKCEKCSKPCARVCYGLGREHLREVRAVTSANIQ
EFAGCKKIFGSLAFLPESFEGNPASNTAPLQPEQLRVFETLEEITGYLYISAWPDNLPDL
SVFQNLQVVRGRVLHDGAYSLALQGLGISWLGLRSLRELSSGLALIHRNPRLCFVHTVPW
DQLFRNPHQALLHSANRPEDECEGLGLACYSLCAHGRCWGPGPTQCVNCSQYLRGQECVE
ECRVLQGQPREYVKDRHCLPCHSECQPQNGSETCFGMEADQCVACAHYKDGPFCVARCPS
GVKPDLSFMPIWKFPDEEGMCQPCPINCTHSCADLDEKGCPAEQRASHVTIITTVVGVLL
FMVVGLILVFVIKRWRQKIRKYTMRRLLQETELVEPLTPSGALPNQAQMRILKETELRKV
KVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVS
RLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVRLVH
RDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQS
DVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXNEDMSPASPLDSTYRSLLEDDDMGDLVDAEEYL
VPQQGFFCPDPAPGSGGTAHRRHRSSSTRSGGGELTLGLEPSEGEPPRSPLAPSEGAGSD
VFDGDLVMGATKGLQSLPSHDPSPLQRYSEDPTVTLPPETDGYVAPLTCSPQPEYVNQPE
VRPQPPSPLAVPLPPSRSAGTTLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPQGGAA
PPPHPPTFSPAFDNLYYWDQDPSERGSPPSTFEGTPTAENPEYMGLDIPV
Download sequence
Identical sequences ENSPCAP00000006065 ENSPCAP00000006065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]