SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006125 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006125
Domain Number 1 Region: 191-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-18
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 2 Region: 139-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 398-435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 4 Region: 33-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000536
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000006125
Domain Number - Region: 304-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000114
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number - Region: 356-396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00301
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006125   Gene: ENSPCAG00000006594   Transcript: ENSPCAT00000006550
Sequence length 709
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7166:599:5570:1 gene:ENSPCAG00000006594 transcript:ENSPCAT00000006550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSTSLLFLLLGGALAHPDRITFPNRACEDPPAVLLAAQGTLQRPLGRDSRSFPANCTWL
ILGSKEQTVTIMFQKLHLACGSEHLILHSPLQPLISLCQAPASPLQLPGGNVTITYTYVG
GRAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVPWTQRCDGFNTCGDGSDEAGCSSDHFF
GPTPAPIPVPPCNRTLEDFYGVFSSPGYSHLTSASHPQSCVWLLDPHDGRRLAVRFTALD
LSYGDAVHVYDGAGPPETSRLLRSLTYFSNGKAVTVETLSGQAVVAYHTVPWSSGRGFNA
TYHVRGYCLPWDRPCGSGSGLGAGESIGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGH
FPCGPVGTPGATACYLPADRCNYQTFCADGADEKRCRHCQPGNFRCRDEKCVYETWVCDG
QPDCADGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPL
SRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGG
TSGARRRQRGRAVRRLIRRLRRWGLLPRTSPSARSPETRSQVTPSTSPLEALDGSTSSAC
EGGAVGGQDRVQAPPLPIKAPLPSASTSPAIPEVPGPLLSAPLEPSLLSGMVQVLRGRLL
ANLHTPGPARTLQGPNTVLSPEDEDDVLLLPLAEPEVWVVEAEDEPLLT
Download sequence
Identical sequences ENSPCAP00000006125 ENSPCAP00000006125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]