SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006358 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006358
Domain Number 1 Region: 316-354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 2 Region: 183-221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 38-101
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000128
Family ATI-like 0.039
Further Details:      
 
Domain Number 4 Region: 665-723
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000768
Family ATI-like 0.059
Further Details:      
 
Domain Number 5 Region: 549-597
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 6 Region: 219-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 142-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 257-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 9 Region: 604-657
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000327
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 10 Region: 940-1010
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000236
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.044
Further Details:      
 
Domain Number 11 Region: 436-474
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000367
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 12 Region: 760-818
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000006358
Domain Number - Region: 816-878
Classification Level Classification E-value
Superfamily FnI-like domain 0.01
Family VWC domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006358   Gene: ENSPCAG00000006630   Transcript: ENSPCAT00000006799
Sequence length 1063
Comment pep:novel genescaffold:proCap1:GeneScaffold_3145:28326:35732:1 gene:ENSPCAG00000006630 transcript:ENSPCAT00000006799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACGCDSERDCECLCSAIATYADECARHGHRLRWRSQELCPLQCEGGQVYDACGPTCPPTC
HDQVPEPRWRCPAAACVEGCFCPEGTLLHGGTCLEPASCPCVWGESFFPPGTVLQKDCGN
CTCRASRWHCGGGSPYCEEPVPSCADGEIPCQEGGQCVPLGWLCDNQDDCSDGSDEEGCA
TPACGEGQFSCSSGRCLPMALRCDGQNDCADGVDEWGCPCPQEYLACSNGHCLPLALLCD
GHPDCPDATDEESCLGPTNCTSDQVSCGDKSCVGASQLCDGIWDCPNGADEGPMHCPLPS
LPTPPAGSLETTPTSPVLSCGPTEFTCGSGECVPRGWRCDQDEDCADGSDESHCGEPCAP
HHASYTPSPGVPRRHLGDPVQRPLHAADPGPHLCVDSVPSDPSPLPPPQSPCSPSPLPTL
VLGRNRTPLLIGPTQLPPCPGLFPCGSAPELCLLPDRICDGTQDCPQAEDELGCEGLPAP
GGPNGTGVSCPEYSCPDGTCIRFQLVRLGVSVVGAVTPRFLPPLTQVCNGQPDCEAVGAT
EPSPEEQGCGTWGPWSSWAPCSQTCGPGVQGRSRHCSPALALVLQHCPGPEYQSQVCFST
ACPVDGEWGPWSAWSPCLEPCAGTTTRQRKCHPPQNGGRSCATLPGGSHSTHQTKPCTQD
GCPNATCPGELVFWPCAPCSLTCEDVAGQAVCLSEQPCSPGCWCPEGQLLGSEGRCVWPR
HCPCLVDGARYWPGQRIATNCQLCVCQDGRPRRCRPSPACNVDCGWSSWSPWAECLGPCG
THSIQWSFRSPSTSQPSGRSSQCRGTHRKARRCQTEPCAQCDWRGQAFRMGQRWRGGPCE
VCQCLHNRTVRCSPYCPLGGCPQGWLLVEGVGTACCHCILPGKNLTAHPTAIPAPTPYNR
PLLATYLLPPPGDPCYSPLGLAGAPQTIWHEVSQQSEHLAWAAPTEGSQGDARLGPHTPT
PLLQLDLQRPWNLTGIRVQDGDSNWCSRHLSLQFSSDGLRWHEDHEVLGSRLHLPEVPFL
RGPVAQTTPLSLQLEGWGAPVQCGEPWADSEGIWFVPGGLSLL
Download sequence
Identical sequences ENSPCAP00000006358 ENSPCAP00000006358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]