SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006640 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006640
Domain Number 1 Region: 798-841,904-971,1016-1038
Classification Level Classification E-value
Superfamily L domain-like 9.52e-18
Family Internalin LRR domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000006640
Domain Number - Region: 1256-1300,1338-1362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000186
Family Motor proteins 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006640   Gene: ENSPCAG00000007027   Transcript: ENSPCAT00000007099
Sequence length 1664
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3146:11:133322:1 gene:ENSPCAG00000007027 transcript:ENSPCAT00000007099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPESVLHCINIIKNKNIAAEELILQDLEDTDILSYSYRSVSDNPVHLRMELSTGCQENPQ
QLMKILSEIEKEEFLRSKTRASSDSAPEPGPHDLPLEEQVFPDDTDINFEYCEVEERCRQ
SFEAWQDKQKELEGQEREALKAQKEREEKQFQEEEEKRHCWLKQFEIEKKKLENFQKQEQ
DKMNNELQKEEKMWEEKFKQHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXKKEYEEKKTSEVKRQIQGEIRVREASKQLTSEPLKKGEDNIKLLTIENT
SENQSDIAEKLVDEKSENRENISLWLVTDTRKSVDRQLIVKAPLQEQLKECISKPPILAE
LKEEEINENLAQEQYSNKLISLKRKHETKNKQPELQSPDLEEDVKEQFKLQELKSQIQKE
GKLKHVIVQNVEQEMHVTLEHNEETNEANNSKAQKITKDNQQKKVQEIEKEKIPQQNAPL
CEESIIRVISLKQKLPPLELENSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXENLIETISCENLENLCILLLNKNQLSSLHGLDGCTNIQNLELSHNKITRI
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXGLESLKSLQQLILDHNQLISTKGLSDTPTIIYLDCSHNHLTEVQGIANCGLLQVL
KLQGNYLSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTEIIPLF
HFVSLEKLDLSNNCLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSLLKMLPDLKI
LNGEILNSYSESHTEEQHQLEPRSFLALYQSQIREFNLLTENCITGKGNVSSLDGAEKLS
YYFKKLMVLSNEYRDAHEHLDLSMERNGLEAQQNHLVPTQTDNLLQNTVLNSCADEHKPD
PSTISKKCIYAGSSYSPLTNSSTCNTMEGRNQEKVADQRKEDTQASNMATKSIPVTKTVV
TTSLLRNCQNVQHNENIMAAMIIQAFWRGYIVHKQTGFSRELQTVAAAHLTSQPNSGLQS
QTLLKEKETGHIVNIQEQREKAAVLIQAVWKGFLLRKKLTTALEAIRYEESEEEYEEIDL
EDFTFDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSGTLEGDDTLSNLPSYPAQAWL
CKEKENMFSPEHAQLNSRSESKISLQIPESKTSRSLLKSKKEEKISEEWGFKAISTAQQM
LKRAQKMKSKKLKEKKDPAVRLALFKSNDSKLSVTKAPKKAQPRRDNYFEGKEELFCKDT
TANEGLERRREYTYQWLHTQVGVHETASSRNIKCNHFLPELDPDVLNGGRVQLVARLASR
EERDLDLFSMTSGSALSVNREKKNQAHRHSAGSSSKLWFPSELI
Download sequence
Identical sequences ENSPCAP00000006640 ENSPCAP00000006640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]