SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006802 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006802
Domain Number 1 Region: 1083-1272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.49e-44
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 2 Region: 209-424
Classification Level Classification E-value
Superfamily L domain-like 1.32e-40
Family Ngr ectodomain-like 0.0022
Further Details:      
 
Domain Number 3 Region: 2-198
Classification Level Classification E-value
Superfamily L domain-like 1.29e-35
Family Ngr ectodomain-like 0.00071
Further Details:      
 
Domain Number 4 Region: 453-551,700-747
Classification Level Classification E-value
Superfamily L domain-like 1.94e-19
Family Ngr ectodomain-like 0.0013
Further Details:      
 
Domain Number 5 Region: 963-1097
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000785
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 856-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000133
Family EGF-type module 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000006802
Domain Number - Region: 1268-1308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000177
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 1354-1388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0002
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 1313-1347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 898-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.026
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006802   Gene: ENSPCAG00000007131   Transcript: ENSPCAT00000007267
Sequence length 1467
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7061:68817:210803:-1 gene:ENSPCAG00000007131 transcript:ENSPCAT00000007267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELNGNNITGIHKNDFAGLKQLRVLQLMENQIGVVERGAFDDMRELERLXXXXXXXXXXXE
LLFQNNQALLRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVL
TLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFTQCSGPA
GLRGLNVAEVQKSEFSCSGQGEAGHVPTCTLSSGSCPAMCTCSNSIVDCRGKGLTAIPAN
LPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYG
NKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFT
SLRAIQTLHLAQNPFICDCNIKWLADFRTNPIETSGARCASPRRLANKRIGQIKSKKFRC
SAKEQYFIPGTEGYQLNSECYSDVVCPHKCRCEASVMECSSLKLTKIPERIPQSTAELRL
NNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGATSVSELHLTANQLESVRGA
MFRGLDGLRTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLDGNQFTLVPGQLSTFKYLQ
LVDLSNNKISSLSNSSFTNMSQLTTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXPPTLAVQAKCDPCLSSPCQNHGTCHNDPLEVYKCTCPGGYKGSNCEVSLDS
CSSGPCENGGTCLTQEGDGAGFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY
TCQCLLQYAGRACEQLVDFCSPDLNPCQHEARCVGTPDGPRCECTPGYTGDNCSENLDDC
TDHRCQNGAQCVDEVNSYSCLCAKGYSGQLCEIPPHPPASRSPCEGTECQNGANCVDQGS
QPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDNGILLYNG
DNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVTFDQMVNLSIDGGSP
MTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQDFT
KTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPVCHCETGWGGLHCDQPADGPCHGHKCV
HGNCVPLDALSYSCQCQDGYSGALCNQAGAPVDPCGGLRCLHGHCQALATKGAHCVCDPG
FSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLTWVECRGACPSQGCCQGLRLKRRK
FTFECSDGTSFAEEVEKPTKCGCALCV
Download sequence
Identical sequences ENSPCAP00000006802 ENSPCAP00000006802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]