SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006901 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006901
Domain Number 1 Region: 482-736
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-51
Family YWTD domain 0.00000864
Further Details:      
 
Domain Number 2 Region: 916-1039
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-18
Family YWTD domain 0.00067
Further Details:      
 
Domain Number 3 Region: 1-70
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000102
Family YWTD domain 0.0005
Further Details:      
 
Domain Number 4 Region: 309-365
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000628
Family YWTD domain 0.00064
Further Details:      
 
Domain Number 5 Region: 1171-1210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000628
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1133-1168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1093-1132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 8 Region: 439-477,730-778
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000154
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 9 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 134-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000228
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006901   Gene: ENSPCAG00000007332   Transcript: ENSPCAT00000007372
Sequence length 1452
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5009:5288:64302:1 gene:ENSPCAG00000007332 transcript:ENSPCAT00000007372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRAN
LDGSFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXYTRCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGKTCKAXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLMYWTDWGENPKIECANLDGQERHVLVNTSLGWPNGLALDLQEGKLYWGDAK
TDKIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXTNPCADRNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVP
EAFLVFTSRAAIHRISLETTNNDVAIPLTGVKEASALDFDVSSNHIYWTDVSLKTISRAF
MNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNP
SLALDPTKGYIFWAEWGGKPRIVRAFMDGTSCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQG
HLDFVMDILVFHSSRQDGLNDCVQNNGQCGQLCLAVPGGHRCSCASHYTLDPSSRNCSXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXYLYFTNMQDRTAKIERAALDGTEREVLFTTGLIRPVALVVDNRLG
KLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLAVLGSHLYWADRQQQMIERIEKTT
GYQRTRVQGRISHLTGIHAAEEVSPEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHL
VLLQNLLTCGEPPTCSPDQFACATGEIDCIPAAWRCDGFPECDDQSDEDGCPVCSAAQFP
CERGQCVDLRLRCDGEADCQDRSDEADCDAVCLPSQFRCASGQCVLIKQQCDSFPDCVDG
SDELMCEITKLPTDDTPAHSSAIGPVIGIILSLFVMGGIYFVCQRVVCQRYAGHNGHFSH
EYVSGTPHVPLNFIAPGGAQHGRRFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXMLNPPPSPATDPSLYNMDLLYSADIPASRRAYRSCIIRGMAPPTTPC
TTDVCDSDYSASCWKASKYYLDLNSDSDPYPPPPTPHSQYLSGEDSCPPSPTTERSYLHL
FPPPPSPCTDSS
Download sequence
Identical sequences ENSPCAP00000006901 ENSPCAP00000006901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]