SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007059 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007059
Domain Number 1 Region: 5-146
Classification Level Classification E-value
Superfamily L domain-like 6.8e-23
Family Leucine rich effector protein YopM 0.067
Further Details:      
 
Domain Number 2 Region: 530-588
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000136
Family SAM (sterile alpha motif) domain 0.0097
Further Details:      
 
Domain Number 3 Region: 630-679
Classification Level Classification E-value
Superfamily RING/U-box 0.00000118
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007059   Gene: ENSPCAG00000007513   Transcript: ENSPCAT00000007543
Sequence length 685
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3423:200317:233333:1 gene:ENSPCAG00000007513 transcript:ENSPCAT00000007543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPFGAFATCKVLQKKVLIVHTNHLTSLLPKSCSLLSLAAIKVLDLHDNQLTALPDDIGQL
TALQXXXXERNLLTCLPRSIGNLSQLQTLNVKDNKLKVLPDTLGELRSLRTLDVSENEIQ
RLPQMLAHVRTLETLSLDASSMVYPPREVCCAGTEAIQQFLCKESGLEYYPPSQYLLPVL
EQDGAENPQDKPDGPRSRLPKEELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQREHAQ
LLQQSSSQKDEILQTVKEEQSRLEQGLSERQRYLDTERQRLREHLKQTEQNISNRIQKLL
EENRRQKKSSEILKSLENEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEMQKAAFEALQVK
KDLMHRQIRNQIKLIETELLQLTQLELKRKSLDTEALQXXXXXXXXXXXXXXXXXXXXXX
QREEELREILMELEAKSETKQENYWLIQYQRLLNQKPLSLKLQEEGMERPLVALLVELSA
EHYLPVFAHHRISLDMLSRMGPDDLAKVGILEAGLQHEILRRVQKLLDAARIQPELLEPP
KEEVSRPPVVPTAPLEPPELVRPSAPPAELEVQTSECVVCLEQEAQMIFLNCGHVCCCQQ
CCQPLRTCPLCRQEITQRLRIYHSG
Download sequence
Identical sequences ENSPCAP00000007059 ENSPCAP00000007059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]