SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007091 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007091
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily L domain-like 2.07e-20
Family U2A'-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007091   Gene: ENSPCAG00000007559   Transcript: ENSPCAT00000007578
Sequence length 609
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2015:2673:29957:1 gene:ENSPCAG00000007559 transcript:ENSPCAT00000007578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELRSLSIPGTYQEKITHLGNSLMRLTGLRSLDLSRNSLVSLEGIQYLTVLERLNLYYNCI
SSLAEVFRLHPLLTLTEVDFRLNPVVKSESDYRLFVVHMLPNLRQLDDRPVRENERKASQ
LHFTSEDLLDSKCGFPAPLKGERPHRCRARYSDSSPQCLALDADDEAVLSLIAECEWDLS
SPPGSTGSSQREREAAFPGVRECRPVPSPPSVWHQCGDPAQRGPERRTSSSLAGRPEKQP
QGLPEEPEARAAHPHASCCPHPDSTDTGDSMTSSQKSSSSTPKVADPVPVSEKYRKRRMP
GGRFQVYPDQECLGCLAGAPGPLTSEESLARLDSLENTSEGTCLHPEIKAPEAEELAPRD
SNVAQESSPCSMWAPPGRTAALQTALLEALLDLVDRHWGGRRSLHSNGAFLAQARRVLSS
AEGLTVTQTAAELDREVAGYLALENEALRGHLAEQEQRHRAKADEARAELEAAQRAADDL
KDHLDKSLEENSSLKSLLCSMKKEAESAGAATTLSMQIAGLQASVTRLSGEIAELKQHLE
HYDKIQELIHMLQESHSSLVSTNEQLLQELGRVRALHRAEVEQLHWSYHELKRTVALFPQ
RSATGQTRD
Download sequence
Identical sequences ENSPCAP00000007091 ENSPCAP00000007091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]