SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007094 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007094
Domain Number 1 Region: 45-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000123
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 5-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007094   Gene: ENSPCAG00000007596   Transcript: ENSPCAT00000007581
Sequence length 276
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6390:7226:168001:1 gene:ENSPCAG00000007596 transcript:ENSPCAT00000007581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEQNCTANPLLCSTARFHCKNGFC
IDKSFICDGQNNCQDNSDEESCESSQEPGSGQLTSENQLVYYPGLTYAIVGSSVIFVLVV
ALLALVLHHQRKRNNMTLPVHRLQHPVMLSRIVVLDHPHHCNVYNVNNGIQYVASQAEQN
ASEAGSPPSYSEALLDQRPAWFDLPPPPYSSDTESLNQADLPPYRSRSGSANSTSSQAAS
SLPSTEDTSHSPRQRGPPEGAAEPRDSPPSRGPEEV
Download sequence
Identical sequences ENSPCAP00000007094 ENSPCAP00000007094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]