SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007251 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007251
Domain Number 1 Region: 18-219
Classification Level Classification E-value
Superfamily L domain-like 4e-32
Family Ngr ectodomain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007251   Gene: ENSPCAG00000007752   Transcript: ENSPCAT00000007748
Sequence length 365
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5711:1026:108310:1 gene:ENSPCAG00000007752 transcript:ENSPCAT00000007748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASELCKTISVARLEHKNLFLNYRNLHHFPLELLKDELQYLERLYMKRNSLTTLPENLAQ
KLPNLVELXXXXXXXXXXXXXIGSLVKLQCLDLSDNALEIVCPEIGRLKALRHLRLANNQ
LQFLPPEVGDLKELQTLDISTNRLLTLPERLHLCLSLQYLTVDRNRLCCVPRHLCQLPSL
NELSMAGNRLAFLPLDLGRSRELQYVYVDNNIHLKGLPSYLYNKVIGCSGXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDFLSPVSLPR
SFLELLRCPLGHCHRCSEPMFTIVYPKLFPLRETPMAGLHQGRTTVSFVAYCCSTRCLQT
FDLLS
Download sequence
Identical sequences ENSPCAP00000007251 ENSPCAP00000007251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]