SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007314 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007314
Domain Number 1 Region: 325-566
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.39e-80
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 2-88
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000157
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 3 Region: 287-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007314   Gene: ENSPCAG00000007808   Transcript: ENSPCAT00000007813
Sequence length 570
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6233:18658:57420:1 gene:ENSPCAG00000007808 transcript:ENSPCAT00000007813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQFKLVALVGYLIRLSIESVQIEADNCVTDSLTIYDSLLPIRSTVLYRICEPTRTPMSF
VSTNNLMLVTIKSPYIQRLSGIRAYFEVIPEQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXTPESTLGIALKFHNYSITKKSLKGCDHGWWEINEHTYCGSYVDHQTIFRV
PSPLVDIQLQGSSRLSDKPLLVEYGSYNISQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXDELFCXXXXXXXXXXXXRQPGLFVCDGIRDVEEGLDEQDWPQSIPCNNRTFKCGNDIC
FRKQNAQCDGTVDCPDGSDEEGCSCSRSSSTPHRIIGGTDTLEGGWPWQVSLHFVGSAYC
GASVISREWLLSAAHCFHGNLSDPTPWTAHGMYVQGNAKFVSPVRRIVVHENYNSQTFDY
DIALLQLSVAWPETLRQLIQPICIPPSGQKVQTGEKCWVTGWGRKHEADNKGPAVLQQAE
VEIIDQTLCVSTYGIITSRMLCAGVMSGKKDACKGDSGGPLSCRRKSDGKWILTGIVSWG
YGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences ENSPCAP00000007314 ENSPCAP00000007314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]