SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007552 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007552
Domain Number 1 Region: 688-940
Classification Level Classification E-value
Superfamily PP2C-like 7.32e-47
Family PP2C-like 0.0015
Further Details:      
 
Domain Number 2 Region: 372-618
Classification Level Classification E-value
Superfamily L domain-like 3.2e-36
Family Leucine rich effector protein YopM 0.011
Further Details:      
 
Domain Number 3 Region: 151-399
Classification Level Classification E-value
Superfamily L domain-like 2.04e-34
Family Internalin LRR domain 0.044
Further Details:      
 
Domain Number 4 Region: 43-151
Classification Level Classification E-value
Superfamily PH domain-like 0.00000012
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007552   Gene: ENSPCAG00000008049   Transcript: ENSPCAT00000008070
Sequence length 1237
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_839:31327:220194:1 gene:ENSPCAG00000008049 transcript:ENSPCAT00000008070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EADEKPLQIQNDYLFPLGFGELWRVQEEGMDSEIGCLIRFYAGKPHSTGSLERIQLSGMY
NVRKGKMQLPVNRWTRRQVILCGTCLIVSSVKDSVTGKMHVLPLIGGKVEEVKKHQHCLA
FSSSGPQSQTYYICFDTFTEYLRWLRQVSKVASQRISSVDLSCCSLEHLPANLFYSQDLT
HLNLKQNFLRQNPSLPAARGLNELRRFTKLRSLNLSNNHLGDFPLAVCNIPTLTELNVSC
NALRAVPAAVGVMHNLQTFLLDGNFLQSLPAELENMHQLSYLGLSFNEFTDIPEVLEKLT
AVDKLCMSGNCMETLRLQALRKMPHIKHVDLRLNLIRKLIADEVDFLQHITQLDLRDNKL
GDLDATVFNNIDVLHCERNQLVTLRVCGYFLKALYASSNELVQLDVYPFPNYLSYMDISR
NRLENVPEWVCESRKLEVLDIGHNQICELPARLFCNSSLRKLLAGHNQLTRLPERLERTL
VEVLDVQHNQLLELPPNLLMKADSLRFLNASANKLETLPPATLSEETRSILQELYVTNNS
LTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKLEELEEVDVSGNKLKAIPTTIMNCR
RMHTVIAHSNCIEVFPEVMQLPEIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXNIRCFKIDQPSAGDASGAPAVWSHGYTEVSGVKNKLCVAALSVNNFCDNRE
ALYGVFDGDRNVEVPNLLQCTMSDILAEELQKTKHEEEYMINTFIVMQRKLGTAGQKLGG
AAVLCHIKHDPVDPGGSFTLTSANVGKCQTVLCRNGKPLPLSRSYSMSCEEELKRIRQHK
AIITEDGKVNGVTESTRILGYTFLHPSVVPRPHVQSVTLTPQDEFFILGSKGLWDSLSIE
EAVEAVRNVPDSLAAAKKLCTLAQSYGCHDSISAVVVQLNVTEDSFCCCDLSAGSTVPPP
SPGIFPPSVNMVIKDRPPDGLGVPSSSSGMASEISSEISTSEMSSEVGSTASDEPPAGAL
NESSPACPSEQRCMLHPVCLSNSFQRQLSSATFSSAFSDNGLDSDDEEPIEGVFTNGSRV
EVEVDIHCNRAKEKERQQGLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRA
NGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQE
QQQQQQQQQQQQPQLQQQLPQRQYPMDQLPDYYDTPL
Download sequence
Identical sequences ENSPCAP00000007552 ENSPCAP00000007552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]