SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007596 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007596
Domain Number 1 Region: 78-213
Classification Level Classification E-value
Superfamily L domain-like 3.64e-34
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 305-421
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.6e-17
Family Hormone receptor domain 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000007596
Domain Number - Region: 242-335
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000208
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007596   Gene: ENSPCAG00000008087   Transcript: ENSPCAT00000008122
Sequence length 1333
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_194:9920:52909:1 gene:ENSPCAG00000008087 transcript:ENSPCAT00000008122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGAPARLLLPLLPWLLLLAPETRGAPGCPVPILSCKCSGERSKGLGGSAPNPARRRVVC
GGGDLPEPPEPGLLPDGTVTLLLSNNRITGLRNGSFLGLSLLEKLDLRNNVISTVQPGAF
LGLGELKRLDLSNNRIGCLTSETFQGLPKLLRLNISGNIFSSLQPGVFDELPALKVVDFG
TEFLTCDCRLHWLLSWARNRSLQLSERTLCSYPSALHAQALGGLQEAQLRCEGALELHTH
HLIPSLRQVVFQGDRLPFQCSASYLGNDTRIRWYHNRAIVEGDEQAGILLRESLIHDCTF
ITSELTLSHIGLWASGEWECSVSTVQGNASKKVEIVVLETSASYCPAERVTNNRGDFRWP
RTLAGITAYQSCLQYPFTSVPLSGGAPGTRASRRCDRAGRWEPGDYSHCLYTNDITRVLY
TFVLMPINASNALTLAHQLRVYTAEAASFSDMMDVVYVAQMIQKFLGYVDQIKELVEVMV
DMASNLMLVDEHLLWLAQREDKACSGIVGALERIGGAALSPHAQHISVNSRNVALEAYLI
KPHSYMGLSCTAFQRREAGAPAAPLGSAGQNPPPELEPLTDQQLSFRCTTGRPNVSLSSI
HIKNSVALASIQLPPSLFSSLPAALAPPGPPDCTLQLLVFRNGRLFRSYSNTSRPGAAGP
GKRRGVATPVIFAGTSGCGVGNLTEPVTVSLRHWAEGAEPVAASWSQEGPGGPGGWSSEG
CQLRSTQPNVSSLHCQHLGNVAVLMELNAFPREVGGSGAGLHPVVYPCTALLLLCLFSTI
ITYILNHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHRAGEAVGKNRLKVLRGGA
AAGAPELLSSESGSLHNSPSDSYAGSSRNSPGASRQHEGEPVLTPSEGSDTSTAPLPEAG
RPGQRRSTSRDNLKGGGGGALETESKRRSYPLNTASLNGAPKGGKYDDINLAGAEVAGGS
RMKTGLWKSETTV
Download sequence
Identical sequences ENSPCAP00000007596 ENSPCAP00000007596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]