SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007670 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007670
Domain Number 1 Region: 124-317
Classification Level Classification E-value
Superfamily L domain-like 8.84e-36
Family Leucine rich effector protein YopM 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007670   Gene: ENSPCAG00000008211   Transcript: ENSPCAT00000008198
Sequence length 367
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5205:15375:36132:-1 gene:ENSPCAG00000008211 transcript:ENSPCAT00000008198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVVVFDISVIRSLWETRAKKHKAWQKKEEERLQKSALEKIKEEWNFVAECRRKGIPQAAY
CKNGFVDTSVRLLEKIERNSLARQSSLSKETDRRRSPFVFELSGEQWTXXXXXXXXXXXX
KEWHITNTIQIIPAYIELFQVMRILDLPKNQISRLPAEIGCLKNLKELNVSFNHLKSIPP
ELGDCENLEKLDVSGNLELTELPFELSNLKQVTFVDLSANQFSSIPICVLRMSDLQWLDV
SNNILNDLPQDIDRLEELQTFLLYKNKLTYLPYALLNLKKLSLLVVSGDHLVEVPTALCD
ASTPVKYVSLMDNPIENTQCQDGDEVMESEQDRKHFDKEFMKAYIEDLKERECVPSYTTK
VSFSLQL
Download sequence
Identical sequences ENSPCAP00000007670 ENSPCAP00000007670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]