SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007685 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007685
Domain Number 1 Region: 174-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000149
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 212-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000243
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007685   Gene: ENSPCAG00000008261   Transcript: ENSPCAT00000008214
Sequence length 263
Comment pep:known_by_projection scaffold:proCap1:scaffold_12596:27007:28518:-1 gene:ENSPCAG00000008261 transcript:ENSPCAT00000008214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP
AMHLPRSSFSKVPGAVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSGPAALKTKPRFDF
ANLALAATQEDPSKLGRAEGPGSPVGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKF
CGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKG
FCQSRTMAVHKTLHSQVKELKTS
Download sequence
Identical sequences ENSPCAP00000007685 ENSPCAP00000007685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]