SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007750 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007750
Domain Number 1 Region: 25-304
Classification Level Classification E-value
Superfamily L domain-like 2.83e-59
Family Ngr ectodomain-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007750   Gene: ENSPCAG00000008335   Transcript: ENSPCAT00000008285
Sequence length 580
Comment pep:known_by_projection scaffold:proCap1:scaffold_9577:32511:34710:1 gene:ENSPCAG00000008335 transcript:ENSPCAT00000008285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKHYLLLLVGCQAWGAGLAYGCPSECTCSRASQVECTGARIVTVPTPLPWNAMSLQIL
NTHITELGESPFRNISALIALRIEKNELSHIVPGAFRNLGSLRHLSLANNKLQVLPIGLF
QGLDNLESLLLSSNQLMQIQPAHFSQCSNLKELQLHGNNLEYIPDSVFDPLVGLTKLNLG
KNSLTHLSPRVFQHLGNLQVLRLYENRLSDIPMGTFDGLRNLQELALQQNQISVLSPGLF
HNNQNLQKLYLSNNHISQLPPGIFMRLPQLNRLTLFGNSLKELSPGIFGPMHNLRELWIY
DNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXILPLRNWLLINRPKLGTDALPVCSSPANVRGQSLVVININVAVPSVRVPEV
PSYPETPRYPDVSRYPAPTSTSFTPGYTSAVEDYTDLTTIGATAGRGIGGMTRAQSGLAI
AAIVIGTVAMACSLAACICCCCCKKRSHAVLMQMKAPNEC
Download sequence
Identical sequences ENSPCAP00000007750 ENSPCAP00000007750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]