SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007838 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007838
Domain Number 1 Region: 62-343
Classification Level Classification E-value
Superfamily L domain-like 3.97e-55
Family Ngr ectodomain-like 0.000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007838   Gene: ENSPCAG00000008406   Transcript: ENSPCAT00000008385
Sequence length 367
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6538:26835:31053:1 gene:ENSPCAG00000008406 transcript:ENSPCAT00000008385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLCLLTALLALSQALPSEQRGFDFTLDDSLLLMNDEEASGAGTASGVPDLDSVTPTFS
AMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDITELRKDDFKGLHHLYLVL
VNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSG
LRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKI
QAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKL
LQVVYLHSNNITKVGVNDFCPVGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAI
QFGNYKK
Download sequence
Identical sequences ENSPCAP00000007838 ENSPCAP00000007838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]