SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007863 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007863
Domain Number 1 Region: 373-434
Classification Level Classification E-value
Superfamily BPTI-like 2.7e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0049
Further Details:      
 
Domain Number 2 Region: 241-304
Classification Level Classification E-value
Superfamily BPTI-like 5.96e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0042
Further Details:      
 
Domain Number 3 Region: 325-363
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007863   Gene: ENSPCAG00000008425   Transcript: ENSPCAT00000008413
Sequence length 436
Comment pep:known_by_projection scaffold:proCap1:scaffold_14730:3511:13405:1 gene:ENSPCAG00000008425 transcript:ENSPCAT00000008413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAPGRMMAGARLSQARIPAAAAAVWLQWALGFPGTEAGPPPLNPGPPAGHACLDLFTAGV
PAFVLDTDASVGNGATFLGSPTVRRDWDCIRACCATQSCNLALVELRPRGLEDDIPSCFL
MNCLYEQNFVCKFAPKEGFINYLLREVYSSYRELQTQGFRGSWVPKAWAGMDLKVQPQEP
LVLRSENTDWHLLQGDTAVRVEKNDLDQVKLWGLQEGTYLFQLTETDSDKPDNTANVTVT
VLSAKQTEEYCLASYKVGRCRGAFPRWYYSPVEQICKSFTYGGCLGNKNNYLREEECKLA
CRDVQGRPVKNFGAQDSPQPVCSGTCQPTQFHCRDGCCIDSFLECDDTADCPDASDEATC
EKYTNSFDELQSFHFPSDKGHCVDLPETGLCQENIPRWYYNPFTEHCARFTYGGCHGNKN
NFEEEQQCLESCRGIS
Download sequence
Identical sequences ENSPCAP00000007863 ENSPCAP00000007863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]