SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008135 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008135
Domain Number 1 Region: 1089-1357
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.1e-64
Family Protein kinases, catalytic subunit 0.000000522
Further Details:      
 
Domain Number 2 Region: 476-633
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000443
Family MAM domain 0.033
Further Details:      
 
Domain Number 3 Region: 263-425
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000285
Family MAM domain 0.01
Further Details:      
 
Domain Number 4 Region: 437-468
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000785
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008135   Gene: ENSPCAG00000008629   Transcript: ENSPCAT00000008703
Sequence length 1619
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2173:86760:396510:-1 gene:ENSPCAG00000008629 transcript:ENSPCAT00000008703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIGFLWLLLTLQSLLSVASGFGTGSSRGTGSLPGGPPVQPREPLSYSRLQRKRLAVDF
VVPSLFRVYTRDLLLPPFSPSDLRSGRPEARSSLALDCSPLLALLGRLPTVSRTGGATSS
PAPARTLSRVLKGGSVRKLRRAKQLVLELGEEAIIEGCVGLPEETAEGLLQFNLSELFNW
WILHGEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIIGTGHSSSGSPTSTASD
SFAWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHEHGNHSWSWRRVPSEEAS
QTDLLDGPEAEHYKEMPKGSFLLLNTSANSKHTISPWMRSSSEHCTLAVAVHRHLQPSGR
YVAQLLPHSEAGREILLAPSPGKHGWTVLQGRIGRPANPFRVALEYISSGNRSLSAVDFF
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHPDCSQGEDEGRLCSNLPPGFYC
DFEDGFCGWTQSTLLPHTPRWQINKLQDARFQDYQGQALLLSTNDAPTSESATMTSATFP
APMKNSPCELRMSWLIRGVLRGNVSLMLVENKTGKEQDKMVWHIATNEGLSLWQWMVLPL
LNVSDRFWLQIVAWWGQGSRATVAFDNISISLDCYLTISGEDKVSQNTAPKSRNLFDRNP
SKELKPWENTPRDTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYRNSNLSVMVGNEGPL
KGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDTLYILVGQQGE
DACPSTSQVIQKVCVGENHVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII
AAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWSGKSLLEGA
TGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFIS
PLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPDSHKVICFCDHGTVLAEDGVS
CIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKL
SKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPN
DPGPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMA
GGDLKSFLRETRPRPNQSSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP
GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLW
EIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXDPDVINTALPIEYGPVTEEEEKVPMRPKDPEGIRPLLVSPQQAQREGERSPG
APPPPPNPASGSAGKKAAAAVVPGRGPRGLAREGGHVNMAFSQSNPPSAVHTVQASRNKP
TSLWNPTYGSWFTEKPARKNTPVARRDDRESPGREGGCAAPPSAAPGRLAGASLLLEPSS
LSARVKEVPLFRLRHFPCGNVNYGYQQQGLPLEPTASPGTSSYKDSVLKSKNSGTQQGP
Download sequence
Identical sequences ENSPCAP00000008135 ENSPCAP00000008135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]