SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008211 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008211
Domain Number 1 Region: 47-314
Classification Level Classification E-value
Superfamily L domain-like 2.38e-55
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 244-448
Classification Level Classification E-value
Superfamily L domain-like 4.59e-41
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 3 Region: 548-702
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000156
Family Rhodopsin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008211   Gene: ENSPCAG00000008751   Transcript: ENSPCAT00000008787
Sequence length 703
Comment pep:known_by_projection scaffold:proCap1:scaffold_462:2679:143450:-1 gene:ENSPCAG00000008751 transcript:ENSPCAT00000008787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAPAVRALWLCAALCASLGIGGAPQLGPGPAACPAPCHCQEDGIMLSADCSELGLSAV
PGNLDALTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPRQAFSGLYSLKILM
LQNNQLGGIPAEALGELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPIR
ALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLD
LNYNELQEFPVAIRTLGRLPELGFHNNNIKAIPEKAFIGNPLLQTVHFYDNPIQFVGRSA
FQYLPKLHTLSLNGATDIQEFPDLKGTTSLEILTLTRAGIQLLPPGMCQQLPRLRVLELS
HNQIEELPSLHWCQKLEEIGLQHNRIWEIGADVSQLSSLRALDLSWNAIRSIHPEAFATL
HSLVKLDLTDNQLTTLPLAGLGGLKHLKLKGNLALSQVFSKDSFPKLRVLEVPYAYQCCA
YGVCASFFKASGQWKAEDFHLDEEEAPKKSLGLLVGQAENHYDLDLDELQLEMEDLKAHP
SVQCSPIPGPFKPCEYLFESWGIRLAVWAIVLLSILCNGLVLLTVFTGGPVPMPPVKFVV
GAIAGANMLTGISCGLLASVDALTFGQFAEYGAWWEMGPGCRATGFLAVLGSEASMLLLT
LATVQCSVSVSRFQAYRKAPSLGSVKARALGCLMLAGLAAALP
Download sequence
Identical sequences ENSPCAP00000008211 ENSPCAP00000008211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]