SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008270 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008270
Domain Number 1 Region: 30-217,290-355
Classification Level Classification E-value
Superfamily L domain-like 4.93e-37
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 413-482
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000713
Family Fibronectin type III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008270   Gene: ENSPCAG00000008879   Transcript: ENSPCAT00000008848
Sequence length 649
Comment pep:known_by_projection scaffold:proCap1:scaffold_15016:32276:34297:1 gene:ENSPCAG00000008879 transcript:ENSPCAT00000008848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGPAWSLFLMGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDA
TTLYLQNNQINNAGIPSDLKNLQKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTIT
YDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEEL
RLDDNRISTISSPSLQGLTSLKRLVLDGNHIDNHGLGDKVXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDSGV
VSTIQITTVIPNTGYPAQGQWPAPVTKQPDIKNPKIAKDQRTTGSPARKTVIITVKSVTS
ETIHISWKLVLPMTALRLSWLKLGHSPAFGSITETIVTGDRSEYLITALEPDSPYRVCMV
PMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPSLPLAAIIGGAVALV
TITLLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
SEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
Download sequence
Identical sequences ENSPCAP00000008270 ENSPCAP00000008270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]