SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008372 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008372
Domain Number 1 Region: 790-1034
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-57
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 454-531
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.96e-20
Family Frizzled cysteine-rich domain 0.00067
Further Details:      
 
Domain Number 3 Region: 208-251
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000000000109
Family Frizzled cysteine-rich domain 0.0023
Further Details:      
 
Domain Number 4 Region: 578-617
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 342-381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 655-696
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 273-305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 383-415
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000106
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 621-653
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008372   Gene: ENSPCAG00000008926   Transcript: ENSPCAT00000008965
Sequence length 1042
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4038:107926:263354:-1 gene:ENSPCAG00000008926 transcript:ENSPCAT00000008965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKQSSALAGEERAHGSARAPEPALGADEDTVADGCSQKLATAKCLRFLLLVLIPCICALV
LLLVILLSFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXHGLLPCRSFCEAAKEGCESVLGMVNLSWPSVLR
CSQFKNQTESNNDRRICFSPEQEKGKQLFCGAGENFLCASGLCVPRKLQCNGYNDCDDWS
DEAHCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCNPTKKHRCGDGHCIAIE
WVCDGDHDCVDKSDEANCSCHSQGLAECRNGQCIPSAFQCDGDEDCKDGSDEESCSDSPT
LCQEGDQRCLHSSCLDSCRGSSLCDPNNSPNTCGQCEPIMLELCMNLPYNHTHFPNYLGH
RTQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDVNTSQRVPPCXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSPSHFKCHSGRCVLASRRC
DGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGVPDCPDNMDEKNCSFCQSDE
LECANHDCVSLDLWCDGAADCSDSSDEWSCVTLSKNVNSSSFLTVHRSAAEYHVCADGWQ
ETLSQLACKQMGLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELLKGQSCQSRSM
ISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWALT
VAHCFEGRESAAVWKVVLGINNLDRPSAFMQTRHVKAIILHPRYSRAVVDYDISIVELSE
AINETSYVRPVCLPSAGQSVEPDTYCYITGWGHMGNKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXGDSGGPLVCEWPGGQWTLFGLTSWGSVCFSKVLGPGVY
SNVSYFVEWIERQIYIHTFILN
Download sequence
Identical sequences ENSPCAP00000008372 ENSPCAP00000008372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]