SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008470 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008470
Domain Number 1 Region: 374-634
Classification Level Classification E-value
Superfamily L domain-like 4.57e-41
Family Ngr ectodomain-like 0.0046
Further Details:      
 
Domain Number 2 Region: 669-819
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.49e-39
Family Toll/Interleukin receptor TIR domain 0.0000409
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000008470
Domain Number - Region: 46-88
Classification Level Classification E-value
Superfamily L domain-like 0.000238
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008470   Gene: ENSPCAG00000009102   Transcript: ENSPCAT00000009074
Sequence length 843
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3419:69884:85682:1 gene:ENSPCAG00000009102 transcript:ENSPCAT00000009074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRVSRLAGTLIPAVTFLSYLRPESWEPCVEXXXXXXXXXXXXXXXKVPDIIPSSAENLD
LSLNPLRYLGSHSFSRFPELHVLDLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICL
TGNRQSYTAKEFVLPSLESLDLSGNGLSFRSCCTQSDFGTTRLKYLDLSFNNVINMGSNF
LGLEQLEHLDIQHSSLKQMNDFSVFLSLTNLLYLDISYTGTEVMFRGIFHGLYSLRVLKM
AGNSFQDNFLPDIFTDLTNLTFLDLSHCKLKQVSQGAFGSLPRLQVVNMSHNNLLSLDLL
PFRYLYSLHILDCSFNHIEASKVQELQHLPSNLTLLNLTQNAFACICEHQSFLQWVKDWR
QLLVDVEQMVCATPPYMERKPVLHFTNTTCEMRKTIISVSVVTVLVVSLILVLVYKFYFH
LMLLVGCKRYGSGECTYDAFVIYSSQDEDWVRSELVKNLEEGVPPFQLCLHYRDFIPGVA
IAANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSHAGIIFIILEKVEKS
LLRQQVELYRLLNRNTYLEWEDSVLGRHIFWRRLRKALLSGKPWSPEETADVENNQPEAT
TFA
Download sequence
Identical sequences ENSPCAP00000008470 ENSPCAP00000008470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]