SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008603 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008603
Domain Number 1 Region: 179-435
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.09e-89
Family Eukaryotic proteases 0.0000542
Further Details:      
 
Domain Number 2 Region: 881-1064
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.77e-60
Family Eukaryotic proteases 0.00045
Further Details:      
 
Domain Number 3 Region: 504-658,692-736
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.95e-45
Family Eukaryotic proteases 0.00022
Further Details:      
 
Domain Number 4 Region: 153-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000589
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008603   Gene: ENSPCAG00000009158   Transcript: ENSPCAT00000009216
Sequence length 1065
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2938:2957:29586:1 gene:ENSPCAG00000009158 transcript:ENSPCAT00000009216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTVDEFQLVPDATQKPPALDSTCCRAAVTTGVTTGVIVLSLGVLLXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRFLLPAVGTLNLGAEGRLLQQGLRARLGD
HGIALAPYGTIVSAELTXXXXXXXXXXXXXXXGCPGNAFFCGNSQCVSKVNPECDDRVDC
ADGSDEAHCDCGLQPAWRTARRIVGGVEASPGEFPWQVSLRENKEHFCGATIMSARWLVS
AAHCFNEFQDPTAWLAYVGTTQLSGSEASTVRARVSRILKHPSYDADTADFDVAVLQLAS
PLPFSRHVQPVCLPAASHVFPPGKKCVISGWGYLKEDFLVKPEVLQKATVELLDQALCAR
LYGHSLTDRMLCAGYLDGQVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGV
YTRVTRLRDWILEAIDMAGMPLAPTVAPAPTTPSSAWPTSPESPVVNTPNRPMLTPSTAP
LDSATASKPQECGARPALEKPIRIVGGFGAASGEVPWQASLKEGSRHFCGATVVGDRWLL
SAAHCFNHTKVEQVRAHLGTASLAGVGGSPVKVGLRRAVLHPLYHAGTLDFDVAVLELAS
PLRFNKYIQPVCLPLAIQKFPVGRKCLISGWGNTQEGDXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFYLAGIVSWSIGCAQAKKPGV
YARITRLKGWILETMSSDPLPTAPHSTARTPATPSHAPRTTAGPTVPAATTDRASPQPAS
RATSQPAPAPTPTPVTVTRSTTRRQTPLANTPAPSTHSQLSXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGDPKQWAAFLGTPFLSGADGQ
LERVARIHKHPFYNLYTLDYDVALLELAGPVRRSRLVRPICLPEPAPRPPAGARCVITGW
GSVREGGAMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVYSCSGDAGGPLA
CKEPSGRWVLTGVTSWGYGCGRPHFPGVYTRVSAVRGWIGQNIRD
Download sequence
Identical sequences ENSPCAP00000008603 ENSPCAP00000008603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]