SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008769 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008769
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.95e-18
Family HkH motif-containing C2H2 finger 0.049
Further Details:      
 
Domain Number 2 Region: 54-77
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000275
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008769   Gene: ENSPCAG00000009438   Transcript: ENSPCAT00000009401
Sequence length 170
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6842:91531:106062:-1 gene:ENSPCAG00000009438 transcript:ENSPCAT00000009401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRYFCDYCDRSFQDSLHNRKKHLNGLQHLKAKKVWYDMFRDAATILVDEQNKRPCWKF
LLIGQCDFGSKCRFSHMSGRDLQELSLQVEXXXXXXXXXXXXXXXXXXXXEDWLEKRAKR
LSSAPSSRAEPTRTAIFQYPMGWPPIQELPPSLRAPPPGGWPLQPSVQWG
Download sequence
Identical sequences ENSPCAP00000008769 ENSPCAP00000008769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]