SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008779 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008779
Domain Number 1 Region: 2-187,333-539
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.15e-49
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0074
Further Details:      
 
Domain Number 2 Region: 1512-1649
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-21
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 1228-1264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000733
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 1100-1138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000982
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 5 Region: 1057-1098
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 6 Region: 665-761
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000275
Family YWTD domain 0.0019
Further Details:      
 
Domain Number 7 Region: 981-1018
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 1143-1176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 9 Region: 1275-1308
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 1375-1412
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000759
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 11 Region: 1415-1454
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 1025-1058
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 13 Region: 1180-1216
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 14 Region: 1926-2007
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000369
Family Fibronectin type III 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000008779
Domain Number - Region: 1819-1862
Classification Level Classification E-value
Superfamily Fibronectin type III 0.01
Family Fibronectin type III 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008779   Gene: ENSPCAG00000009213   Transcript: ENSPCAT00000009411
Sequence length 2116
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3473:5127:215118:1 gene:ENSPCAG00000009213 transcript:ENSPCAT00000009411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPRSSDVYVSYDYGKSFKKISEKLNFG
VGNSSESVISQFYHSPADNKRYIFVDAYAQYLWMTFDFCNTLQGFSIPFRAADLLLHSKA
SDLLLGFDRSHPNKQLWRSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYS
TVFRSTDFFQSRENQEVILEEVKDFQLRDKYMFATKVVHLLGILQQPSVQLWVSFGRKPM
QAAQFITRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPG
GPGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQA
PAFTGYGEKINCELSQGCSLHLAQRLSQLLNFQLRRMPILSKESAPGLIVATGSVGKNLA
SKTNVYVSSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFL
FSERPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSP
SDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLS
LEVCVPDPEFSGKSYYPPVPCPVGSTYRRTRGXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XENEFILYATRKSIHRYDLASGAAEELPLTGLRAAVALDFDYEHNCLYWSDLALDIIQRL
CLNGSSGQEVIISSGLETVEALAFEPLSQLLYWVDAGLKKIEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXSNACVSKPCSLLCLPKANHSRICRCPEGVSSKVLPSGD
LLCDCPQSYQLENNTCVKEDNTCLRNQYRCSNGKCINSIWWCDFDNDCGDMSDERNCPTT
VCDLDTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCETHQCRSDEYSCSSGMCIRSSW
VCDGDNDCRDWSDEANCTAIYHTCEASNFQCHNGHCIPQRWACDGDSDCQDGSDEDPVNC
EKKCNGFRCPNGICIPSSKHCDGLYDCADGSDEQHCEPLCTRFMDFVCKNRQQCLLHSMV
CDGIIQCRDGSDEDSTFAGCSQDPEFHKVCDEFSFQCQNGVCISLIWKCDGMDDCGDYSD
EANCENPTETPNCSRYFRFQCENGHCIPNRWKCDWENDCGDWSDEKDCGXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVTAVSTATQLGRCDRFE
FECQQPGKCIPNWKRCDGRQDCQDGQDEANCPTHSTLTCTGREFRCEDGETCIVLSERCD
GFLDCSDSSDERACSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
GESIWISSETHRNKTSAALKVLKPDTTYQVKVQVQCLNKVHNTNDFVNLRTPEGLPDAPQ
NLQLSLYSEAEGVIVGYWTPPAHTHGLVREYIVEYSRSGSKIWTSQRAASNFTEIKDLLV
NVLYTVRVAAVTSRGIGNWSDPKSITTIKGKVAPRPDIHIDDYGENSLSFTLTMDSDITV
RGYVVNLCWAFDNHQQGKTTLNLQGSGLSHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKSLTTSLHNS
TVTVSRDEQYLLVRVVVPYQGPSSDYIVVKMIPDSRLPPRHLHAVHTGKTSAVIKWESPY
DSPDQDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSKDCS
IKITTVSLSAPDALKILTENDHILLFWKSLAIEEKHFNESRGYEVHMFDSTLNVSAYLGN
TTDNFFKISNLKMGHNYFTVQAKCLFGSQICGEPALLYDDLGTGADASAIQAARSTDVAA
VVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDED
APMITGFSDDVPMVIA
Download sequence
Identical sequences ENSPCAP00000008779 ENSPCAP00000008779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]