SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009008 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009008
Domain Number 1 Region: 31-106
Classification Level Classification E-value
Superfamily L domain-like 0.0000000257
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009008   Gene: ENSPCAG00000009670   Transcript: ENSPCAT00000009653
Sequence length 536
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4575:15548:22152:-1 gene:ENSPCAG00000009670 transcript:ENSPCAT00000009653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLGMLLLLLLAGARVGVAWRPPKGKCSPRCSCSKDSALCEGSPDLPEGFPPTLLSLSL
VRTGVTQLRAGSFLRVPSLHLLLFTSNAFSVIEDDAFAGLSHLQYLXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCRMLWLLQWMASVNAS
VGTDCAGPTALAHLELRHLDPKMFKCRAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQHFQKEELSAPSVVSCKPLVLGLRLFVLAARLWGGSQLWARASPDL
RLAPMQALAPRRLLRPNDAELLWLDGQPCFVVADASKAGSTTLLCRDGPGFYPRQSLHPW
HRDTDAEALELDGRPHLLLASVSQRPVLFHWLGGRFERRTDIPEAEDVYATHHFQAGGEV
FLCLTRYIGDSMLMRWDGSMFRLLQKLPSRGAHIFQPVLIARDQLAILGSDFAFSHVFRL
EPDKRLLEPLQELGPPALVAPRAFAHIAMAGKHFLFAACFKGPTQIYQIHELDLSA
Download sequence
Identical sequences ENSPCAP00000009008 ENSPCAP00000009008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]