SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009014 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009014
Domain Number 1 Region: 44-374
Classification Level Classification E-value
Superfamily L domain-like 4.76e-40
Family Ngr ectodomain-like 0.037
Further Details:      
 
Domain Number 2 Region: 443-548
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.58e-26
Family Toll/Interleukin receptor TIR domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009014   Gene: ENSPCAG00000009711   Transcript: ENSPCAT00000009659
Sequence length 548
Comment pep:known_by_projection scaffold:proCap1:scaffold_68826:13857:15500:-1 gene:ENSPCAG00000009711 transcript:ENSPCAT00000009659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNFSNAISGSQTSSLVLAHHIMGSGFGFHNIRDPDRSTFAGLARSSVIHLDLSYGYIFSL
NFRLFETLRELKALNLAHNKINKIVEGAFYGLHSLQVLNLSYNLLGELYDYNFNGLPKVS
YVDLQKNHIGIIQNQTFRFLKNLHTLDLRDNALKTINSIPSIPTIFLGGNKLETLPDISL
KANFIHLSENRLENLADVYFLLQVPHLQTLLVDQNRLSACSQRHGHPAQNLSVETLFLGR
NMLQLAWETRLCWDIFKGLSHLQILYLNSNYLTFLPPGVFSDLTALRGLDLSTNKLTVLS
PGDLPASLEILDVSWNQLLSPDPSLFASLTAVNVRHNSFVCGCELSPFISWLNQTNVTVL
GAPADMYCTFPMEVLGVSLFSVSMEMCDEERAFQALKFSLFIFFTIVLMLFLITVLTVTK
FRGFCFLCYKTAQGLVSRGHRQGPDTDPYKYDAYFCFSSKDFEWVQNALLKCLDVQYSDQ
NRFNLCFEERDFVPGENHIANIQEAVWSSRKIVCLVSRHFLQDGWCLEAFSYAQGRCLSD
LSSDLIMV
Download sequence
Identical sequences ENSPCAP00000009014 ENSPCAP00000009014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]