SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009024 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009024
Domain Number 1 Region: 221-444,492-572
Classification Level Classification E-value
Superfamily L domain-like 6.46e-34
Family Ngr ectodomain-like 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000009024
Domain Number - Region: 46-98
Classification Level Classification E-value
Superfamily L domain-like 0.000442
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009024   Gene: ENSPCAG00000009700   Transcript: ENSPCAT00000009670
Sequence length 575
Comment pep:known_by_projection scaffold:proCap1:scaffold_67427:1244:3951:1 gene:ENSPCAG00000009700 transcript:ENSPCAT00000009670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFWMYTLNRLFLIFLSAMLISITLGAMWFPKTLPCNVTVDVSEAHVIVDCTDKHLIEIPG
GIPTNATNLTLTINHIPAISQDSFHSLEHLVIDFRCNCIPTRLGPKHICTKRLQIKPSFS
HLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTVLPPTLIELHLYNNIITTIQEHD
FLNLNQLQLLDLSGNCPRCYNVPFPCTPCENNSPLKIHENAFDGLTELRILRLHSNSLQH
VPKRWFQNIGKLEELDLSQNFLAKEFGDAEFLHCLPKLVQLDLSFNYELQVYHAHMTLSN
AFSSLQNLRILRIRGYVFKELKSSNLSPLQNLTKLEVLDLGTNFIKVADLSIFKQFERLK
VIDLSVNKISPSGDSGEVDFCPKTRTSVGVYGPLVLEAGHYFRYDEYARSCRFKHEETSI
SYSNGICSRYGQTLDLSRNNIFFIKSFDFQHLSFLKCLNLSGNSISQTLNGSEFQPLVEL
KYLDFSNNRLDLLYSTAFEGLHNLEVLDISSNGHY
Download sequence
Identical sequences ENSPCAP00000009024 ENSPCAP00000009024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]