SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009045 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009045
Domain Number 1 Region: 548-702
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-36
Family MAM domain 0.00089
Further Details:      
 
Domain Number 2 Region: 865-1028
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-31
Family MAM domain 0.0026
Further Details:      
 
Domain Number 3 Region: 62-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-29
Family MAM domain 0.0051
Further Details:      
 
Domain Number 4 Region: 705-862
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-26
Family MAM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 268-419
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000744
Family MAM domain 0.027
Further Details:      
 
Domain Number 6 Region: 222-258
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000009045
Domain Number - Region: 470-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000158
Family MAM domain 0.033
Further Details:      
 
Domain Number - Region: 437-476
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009045   Gene: ENSPCAG00000009626   Transcript: ENSPCAT00000009691
Sequence length 1099
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7519:49443:56950:1 gene:ENSPCAG00000009626 transcript:ENSPCAT00000009691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRPGHLLATLALLTAGSLGGAWDPSYCRSPREAVCNFVCDCRDCSDEQRCGFHGAAPAP
GTPFTCDFEQDPCGWHDISTSGYSWLWDRAGAGLAAHTDHTLGTDLGWFVAVDTHRGKEP
STAALRSPLLRQAAASCQIQLWFHAFSGDVAELRLELTHGTETLSLWRSSGPWDRGWQEL
MVATGRIRGDFQVTFSATRNATHRGAVALDDVAFWDCGLPTPRTSCSLGQHRCQNKACVE
PHQLCDGEDNCGDRSDEDLDTCGRHTAADFETGLGLWDSSEGWSRNNSTGGHGHPAWPHR
DHSLNSAKGFFLIVADPVAPAVLSSPKLRASGAAPCTFVLYHYLHGSEAGSLQLSLQSQD
PAAPWTSILLRSRRGELGDWVRDQVDIQSAHPFQILLVGQTGPEGVVGLDDLILSEHCTP
ELEPSVLQTLPPQRQDSCEPGHLSCGELCVPPEQLCDFQQQCPGAEDEQQCGTTDFESSA
GGWEDASVGRLQWQRLAPQESGTAGHFLSLQRAWGQLETAARVLTPALGPSGPACELHLA
CCFQSQPQEVSCNFERDMCGWHIGHLTDVHWHRVKSSGPDYDHTTGRGHFVLLNPTEPLA
RGPGAQLLTGLQMPAAPTECLSFWYYLHGPQIGTLLLAVKPEGAEETVLWSRSGSHGNQW
HQAWATLSHKPGSKYQLLFEGLRDGFQGTMGLDDVTMRPGPCWAPRRCSFEDSACGFSTD
GQGLWQRQSNASGQAAWGPQADHTTETAQGHYMVVNMSPQALPHGHVASLTSEEHAPLAQ
PACLAFWYHLSLGNPGTLRVHVEEGGRQQVLSISTHGGLAWSLGSVEVQAERPWRVVFEA
EAAGVEHSYIAVDDLSLQDGPCPRPASCDFESGLCGWSRLAWPGLGRYSWDWSSGATPSR
YLQPPVDHTLGTAAGHFTFFETGVLGPGGRAAWLRSEPLPATEGSCLRFWYHMGFPEHFY
KGELRVLLGSARGQLAVWAAGGRQRHQWLQGQVEVASPEEFQVLFEATLGGQPALGPIAL
DDIEYLAGQACRMLAPSQGGGYMHASVPIVISGAFLFLLLLGLLALGGRHWLRKRGDCPI
VGSREAGAALGFDNVLFNA
Download sequence
Identical sequences ENSPCAP00000009045 ENSPCAP00000009045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]